KEGG   Lactobacillus rhamnosus Lc 705: LC705_02078Help
Entry
LC705_02078       CDS       T00990                                 

Definition
ATP-dependent exoDNAse
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LC705_02078
Enzymes [BR:lrl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LC705_02078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2106248..2108347)
Genome map
AA seq 699 aa AA seqDB search
MPQTQVYENVDLQIIKLLFNSDTSDYKVYAVRILNPNPALKMTLTQEATVTGDMGYYNQR
AIITADLVYDDADSLRYRKPSYKVARLHFGLPKEPRRQWQLLETLLVHQPTVLRRLHEAF
ADDEPILATFSKATIKDARIPGIGSATIQKIAMAIRGKLEVAVLANHWGKALSSMTYEKI
WLAYKDAELAMHHIDANPYLLMQVAQFDFKKADAFAKSRGVAANDPHRLAAGLQYIFRTA
VLTQGLTYITITWFKQQAATLLGVRAEDLTMFADPKQALAYGFLLNEQYDLVTSCDMFAT
EGSVAKIMTVAQKTAEPLIKPEELDDKLDQFLDRHQLVINDQQRAAFQNVNRHGLSVLNG
SAGTGKTWLTNLLVHFFNAQAKGKSVLLAPTGRAAKVLAKYTHEPAATIHAYLHLLPGEE
VERFNAESDWETFGDARLIIVDESSMLTTPLAHTVLKHVNFKKAHVLFVGDVFQLPPIGP
GNFLKDCLADSQVAATTLTRVYRQDAQSGVLALANRIRDRLPLPFGPDDDRYVSGNVALY
NQRDAGRVFDAGIKAYQDALAKNGHELDSQLLIVNKNVGATGRLRFNAELQALVNPTRPG
EEEYVSSYVDPVTKQKHHLRMRDRVMILKNDKHVALVDPKTWERRAVLGENGLQQTDEFG
TKRWRETIMANGDTGVIAHIDTKRRFLVVQVGQLLLQFR
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
gtgccacagactcaggtttatgaaaatgttgacttgcagattattaagttattgttcaac
agtgataccagcgattataaagtttacgcggtgcggattttaaacccgaatccggcgctc
aaaatgacgctcacgcaagaagccacggtgaccggcgatatgggctattacaatcagcgt
gccattatcactgctgatttggtttatgatgatgccgattcactgcgctatcggaaaccg
tcttataaagtggcgcggctgcattttgggttaccgaaagaaccccgccgccagtggcaa
ttgcttgaaaccttgctcgtacaccagccaacggttttacgccgcttgcatgaagcgttt
gccgatgacgagccgattttggcgactttttcaaaagccacgattaaggatgcacggatt
ccggggatcgggtcggcaacgatccaaaaaattgccatggccattcgcggcaagcttgag
gttgcagtgttggctaaccactggggtaaagcactcagttcgatgacgtatgagaaaatc
tggctggcgtataaagatgctgagctggccatgcaccatattgatgccaatccttattta
ctgatgcaagtggcgcagtttgatttcaaaaaggcggatgcgtttgctaaaagtcgtggg
gttgcggccaatgatccgcatcggctcgctgccgggttgcagtacattttccggacggcg
gttttgacgcaagggttgacctacattacgatcacgtggttcaagcagcaagcagccacg
ttattaggcgtgcgcgccgaagacctgacgatgtttgctgaccctaagcaggcgttggcg
tatggctttttgttaaatgaacagtatgacttggtgaccagctgcgatatgtttgccacg
gaaggctcagtggccaaaatcatgacggtggcgcaaaaaaccgcagagccactgatcaag
ccggaagaactggatgataaactggatcaatttttggatcgccatcaactcgtcatcaac
gaccagcagcgcgccgcttttcagaatgtgaatcggcatgggctaagtgtgctgaatggc
agtgcgggcaccggtaagacttggttgaccaatttgctggttcactttttcaatgcccag
gcgaaggggaaaagtgtgttgctggcaccaaccgggcgggccgcgaaggtgttggcgaag
tatacgcacgaacctgccgccacgattcacgcgtacttgcacttgctgccaggcgaggag
gttgagcggttcaatgctgagtctgattgggagacgtttggtgatgcgcggttgatcatt
gtcgatgaaagctcgatgttaaccacacccttggcccataccgtgttgaaacacgtgaat
ttcaaaaaggcgcacgtgttgtttgtcggcgatgtctttcagctgccgccaattggtccg
gggaactttttgaaggactgtttagccgattcgcaggtggcggccacaactttgacgcgc
gtttatcgtcaggatgcgcaatcaggggtgctggcgctggccaatcgaattcgggatcga
ctgccactgccattcgggccggatgatgatcgctatgtcagcggcaatgtggcactttac
aatcagcgcgatgccggccgcgttttcgatgccggaatcaaggcgtatcaagacgcgcta
gccaaaaatggccatgagctggactcgcaacttttaattgtgaataaaaatgtgggcgct
actggtcgactgcgatttaatgccgaactgcaggccttggtcaatccgactaggccaggg
gaggaagaatacgtcagcagttatgtcgatccggtgaccaagcaaaagcaccatttgcga
atgcgtgatcgggtcatgattttaaaaaatgacaagcatgtggcgctggttgatcctaag
acctgggagcggcgcgcagttttaggcgaaaacgggttgcagcaaaccgacgaattcggg
acaaaacgttggcgggagacgattatggccaatggtgataccggtgtgattgcccatatt
gataccaagcggcggtttctggttgtccaagttggccagctgttattacagtttcggtag

DBGET integrated database retrieval system