KEGG   Lactobacillus rhamnosus Lc 705: LC705_02078Help
Entry
LC705_02078       CDS       T00990                                 

Definition
ATP-dependent exoDNAse
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lrl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2106248..2108347)
Genome map
AA seq 699 aa AA seqDB search
MPQTQVYENVDLQIIKLLFNSDTSDYKVYAVRILNPNPALKMTLTQEATVTGDMGYYNQR
AIITADLVYDDADSLRYRKPSYKVARLHFGLPKEPRRQWQLLETLLVHQPTVLRRLHEAF
ADDEPILATFSKATIKDARIPGIGSATIQKIAMAIRGKLEVAVLANHWGKALSSMTYEKI
WLAYKDAELAMHHIDANPYLLMQVAQFDFKKADAFAKSRGVAANDPHRLAAGLQYIFRTA
VLTQGLTYITITWFKQQAATLLGVRAEDLTMFADPKQALAYGFLLNEQYDLVTSCDMFAT
EGSVAKIMTVAQKTAEPLIKPEELDDKLDQFLDRHQLVINDQQRAAFQNVNRHGLSVLNG
SAGTGKTWLTNLLVHFFNAQAKGKSVLLAPTGRAAKVLAKYTHEPAATIHAYLHLLPGEE
VERFNAESDWETFGDARLIIVDESSMLTTPLAHTVLKHVNFKKAHVLFVGDVFQLPPIGP
GNFLKDCLADSQVAATTLTRVYRQDAQSGVLALANRIRDRLPLPFGPDDDRYVSGNVALY
NQRDAGRVFDAGIKAYQDALAKNGHELDSQLLIVNKNVGATGRLRFNAELQALVNPTRPG
EEEYVSSYVDPVTKQKHHLRMRDRVMILKNDKHVALVDPKTWERRAVLGENGLQQTDEFG
TKRWRETIMANGDTGVIAHIDTKRRFLVVQVGQLLLQFR
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
gtgccacagactcaggtttatgaaaatgttgacttgcagattattaagttattgttcaac
agtgataccagcgattataaagtttacgcggtgcggattttaaacccgaatccggcgctc
aaaatgacgctcacgcaagaagccacggtgaccggcgatatgggctattacaatcagcgt
gccattatcactgctgatttggtttatgatgatgccgattcactgcgctatcggaaaccg
tcttataaagtggcgcggctgcattttgggttaccgaaagaaccccgccgccagtggcaa
ttgcttgaaaccttgctcgtacaccagccaacggttttacgccgcttgcatgaagcgttt
gccgatgacgagccgattttggcgactttttcaaaagccacgattaaggatgcacggatt
ccggggatcgggtcggcaacgatccaaaaaattgccatggccattcgcggcaagcttgag
gttgcagtgttggctaaccactggggtaaagcactcagttcgatgacgtatgagaaaatc
tggctggcgtataaagatgctgagctggccatgcaccatattgatgccaatccttattta
ctgatgcaagtggcgcagtttgatttcaaaaaggcggatgcgtttgctaaaagtcgtggg
gttgcggccaatgatccgcatcggctcgctgccgggttgcagtacattttccggacggcg
gttttgacgcaagggttgacctacattacgatcacgtggttcaagcagcaagcagccacg
ttattaggcgtgcgcgccgaagacctgacgatgtttgctgaccctaagcaggcgttggcg
tatggctttttgttaaatgaacagtatgacttggtgaccagctgcgatatgtttgccacg
gaaggctcagtggccaaaatcatgacggtggcgcaaaaaaccgcagagccactgatcaag
ccggaagaactggatgataaactggatcaatttttggatcgccatcaactcgtcatcaac
gaccagcagcgcgccgcttttcagaatgtgaatcggcatgggctaagtgtgctgaatggc
agtgcgggcaccggtaagacttggttgaccaatttgctggttcactttttcaatgcccag
gcgaaggggaaaagtgtgttgctggcaccaaccgggcgggccgcgaaggtgttggcgaag
tatacgcacgaacctgccgccacgattcacgcgtacttgcacttgctgccaggcgaggag
gttgagcggttcaatgctgagtctgattgggagacgtttggtgatgcgcggttgatcatt
gtcgatgaaagctcgatgttaaccacacccttggcccataccgtgttgaaacacgtgaat
ttcaaaaaggcgcacgtgttgtttgtcggcgatgtctttcagctgccgccaattggtccg
gggaactttttgaaggactgtttagccgattcgcaggtggcggccacaactttgacgcgc
gtttatcgtcaggatgcgcaatcaggggtgctggcgctggccaatcgaattcgggatcga
ctgccactgccattcgggccggatgatgatcgctatgtcagcggcaatgtggcactttac
aatcagcgcgatgccggccgcgttttcgatgccggaatcaaggcgtatcaagacgcgcta
gccaaaaatggccatgagctggactcgcaacttttaattgtgaataaaaatgtgggcgct
actggtcgactgcgatttaatgccgaactgcaggccttggtcaatccgactaggccaggg
gaggaagaatacgtcagcagttatgtcgatccggtgaccaagcaaaagcaccatttgcga
atgcgtgatcgggtcatgattttaaaaaatgacaagcatgtggcgctggttgatcctaag
acctgggagcggcgcgcagttttaggcgaaaacgggttgcagcaaaccgacgaattcggg
acaaaacgttggcgggagacgattatggccaatggtgataccggtgtgattgcccatatt
gataccaagcggcggtttctggttgtccaagttggccagctgttattacagtttcggtag

DBGET integrated database retrieval system