KEGG   Lactobacillus rhamnosus Lc 705: LC705_02161Help
Entry
LC705_02161       CDS       T00990                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LC705_02161 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LC705_02161 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LC705_02161 (thrC)
Enzymes [BR:lrl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LC705_02161 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2192220..2193734)
Genome map
AA seq 504 aa AA seqDB search
MRYTSTRDQRVSKTGQQAIKQGISEEGGLFVLPHLTDYRLNLQNLLGKDYETIAQNVLTT
LLPDFNTAALKKAIQFAYHKNFSDRRLTPVRSVGDFHVLELFHGPTSAFKDLGLQLLPQL
MRLALDPEDRIMILAATSGDTGTAALQGFKNVAQTGITVFYPDHGVSPIQERQMLTTTGN
NTRVFPIGGNFDQAQSAVKDLFTDTGFAARLQAEQVTLSAANSINIGRLIPQVVYYFSAY
LQLVESGAIELGQKVNFTVPTGNFGDVLAGFYAKLLGLPIHQLIAAANANHELADFLETG
IYDRNRPFLKTVAPSMDIQISSNLERLLYYKSGEDSRYVAKLMEELATTGRYQVRPDVLA
AIQADFAGGFAADAQIAASIAAVWKQNGYLLDPHTAVGYHVMQQYRETTGDPTPNVLLAT
ASPYKFPRAVAQALDLPVTGDDFAVMTQLQQMSGVPIPANLARLATLTAQPKHVVAPDKM
GQAIIAAAKEVFNDDQRVRSGNKR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgcgatacacaagtacacgggatcagcgcgttagcaagactggacaacaagcgatcaag
caaggcatctccgaagaaggcgggttatttgttttaccgcatttgacggattaccgcttg
aatcttcaaaatttattaggtaaagattatgaaacgattgctcagaatgttctcacgacc
ctgttgcctgattttaacactgctgcgctgaaaaaggcgatccaatttgcatatcataaa
aatttttctgatcgccggctgacgcctgttcggtctgtgggtgattttcatgttttagag
ctatttcatggcccaaccagcgcctttaaagacttggggttgcaactactaccccaattg
atgcgcctggcactggatccggaagatcgcatcatgatcttagccgcaaccagtggcgat
accgggactgcagcgttgcagggcttcaaaaatgtcgcccaaaccgggattaccgtcttt
tatcctgatcatggggttagtccgattcaggagcggcaaatgttaacgacaaccggcaat
aacacacgggttttcccaattggcggtaattttgatcaagcgcagagtgccgttaaagat
ctctttaccgacaccggttttgcggcgcgtttgcaggcggaacaagtaacgctttcggcc
gccaattcgattaatatcgggcgcttgattccccaggtggtttattatttttccgcctac
ttgcaactggttgaatcaggtgccattgagctgggtcaaaaggttaacttcaccgttccg
actggcaactttggggatgtcctagctggtttctacgcgaagttattgggtttgccgatt
catcaattaattgccgcggccaacgccaaccatgaactggcggactttcttgaaaccggt
atttatgatcgcaatcgcccgttcctaaagacggttgcgccaagtatggatattcagatt
tccagtaacttggaacggctactctactataagagtggtgaagatagcagatatgtggct
aagttaatggaagaattggccacaaccggccgctatcaggtacggcccgatgttttggca
gcgattcaggctgattttgctggcggttttgccgcagatgcgcagattgcagcttcaatt
gctgcggtttggaagcaaaacggctatttgttggatcctcacacggctgtcggctaccat
gtgatgcagcaatatcgggagacaaccggcgatccgacgcctaatgtgttactcgcaacg
gctagtccatacaaatttccacgtgcagttgctcaagcccttgacttgccggtgacaggt
gacgactttgccgtgatgacccagttacaacaaatgagtggtgttccgattcctgctaat
ttagcgcgcttggcaactttgactgcccaacctaaacacgtggtggcgccggacaaaatg
ggtcaggcgatcattgcagccgcaaaggaggtttttaacgatgatcagcgtgtccgttcc
ggcaacaagcgctaa

DBGET integrated database retrieval system