KEGG   Lactobacillus rhamnosus Lc 705: LC705_02345Help
Entry
LC705_02345       CDS       T00990                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
lrl00010  Glycolysis / Gluconeogenesis
lrl00260  Glycine, serine and threonine metabolism
lrl00680  Methane metabolism
lrl01100  Metabolic pathways
lrl01110  Biosynthesis of secondary metabolites
lrl01120  Microbial metabolism in diverse environments
lrl01130  Biosynthesis of antibiotics
lrl01200  Carbon metabolism
lrl01230  Biosynthesis of amino acids
Module
lrl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lrl_M00002  Glycolysis, core module involving three-carbon compounds
lrl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LC705_02345 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LC705_02345 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LC705_02345 (gpmA)
Enzymes [BR:lrl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LC705_02345 (gpmA)
Membrane trafficking [BR:lrl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LC705_02345 (gpmA)
Exosome [BR:lrl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LC705_02345 (gpmA)
  Exosomal proteins of melanoma cells
   LC705_02345 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAR91184
Position
complement(2390613..2391284)
Genome map
AA seq 223 aa AA seqDB search
MVKLVLLRHGESIANQQNTYTGWSDVGLTAQGKAQAAAAGKKIAATGILFEHVHTSVLSR
AIMTAYIVQDAIGQNYLPITKSWRLNERHYGALRGINKDLTRKLFGPDQVASWRRSFYAH
PPLLAHPSRSRRYHAYPATIIPRGESLADASERLLPYWSAELAPRLMAGKNQLIVAHGST
LRALVKYMEAISDAGINKVEIGNAQPIVYTLDQHLTILNKQTL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaaattagtccttttaagacatggcgaaagcattgctaatcaacaaaatacttat
actggctggtccgatgtcggattaacggcgcaagggaaagctcaagcagcagctgccggc
aaaaagattgcggcgaccgggatcttatttgagcatgtgcataccagcgtgttatcgcgg
gccattatgactgcctacatcgttcaggacgcaatcggccagaattacctgccgatcact
aaaagttggcgtctgaacgaacggcattatggcgccttacgcggaattaacaaagatctg
acccggaaactttttggcccggatcaagttgccagctggcggcgaagcttttatgcgcat
ccgccgttgttggcacatcccagtcgttcacggcgctatcacgcgtacccggcgacgatt
attccgcgcggtgaaagtcttgccgatgcgagtgagcgcctgttgccgtattggagtgcc
gaactggcgccgcggttgatggccggcaagaatcagcttatcgtggcgcacggctcaacg
ttacgggcattagtcaagtacatggaagctattagcgatgctggtattaacaaagttgaa
attggcaatgcccaacctatcgtctacacgcttgatcagcatttaaccattctcaataaa
caaacactgtga

DBGET integrated database retrieval system