KEGG   Lactobacillus rhamnosus Lc 705: LC705_02577Help
Entry
LC705_02577       CDS       T00990                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:lrl00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2612676..2613554)
Genome map
AA seq 292 aa AA seqDB search
MELIEKAPAKINLSLDALYRHADGEHEWQMVMTSVDLADYVSIKPSHSIQVSTDSGFLPE
DPRNLAYKAALALQRHANIRQGARIHIEKHIPVAAGLGGGSSDAAAVLRGLNSLWQLGYS
RSQLARIGLQVDSDVPYCVYSETALVTGRGDVVTPLGSLPNFWVVLAKPRVSVSTPSILN
AIDYQAGLLHPNTPEVVAGVQNHDFNQMISGMGNSLEAITASRYPEMTALKQRLKKYGAE
IAQMSGSGPTVFGLCQKHSRAMRVYNSMKGFCREVYLLRPFCLSTNSHRLRG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaactgatcgagaaagcaccggccaagattaatctaagtttggatgctttgtatcgt
catgctgacggcgaacatgagtggcagatggtgatgacatcagttgatttggctgattac
gtgagcatcaagcctagccatagcattcaggtttccacagatagcggttttttacctgaa
gatccgcgaaatctggcctataaagcggcattggcgctccaacgccatgccaatatccgc
caaggtgcgcggattcatattgaaaaacacattcccgtcgctgcaggtttgggcggtggt
tcgagtgacgcagccgccgttttgcgtggcttgaattcactatggcagttaggttatagt
cgctcgcagctggctcgcatcggcttacaggttgatagcgatgtgccttactgcgtttac
tcggagacggccttggttaccggacgcggtgatgtggtcaccccattgggaagtttaccg
aacttttgggttgttttggctaagccgcgggtgtcagtgtcaacgccaagtattcttaat
gcaattgactatcaggccggccttttgcaccccaatacacctgaagtcgttgccggggtt
caaaaccatgatttcaaccaaatgattagcggaatggggaatagtttagaggccattacg
gcaagtcgttatcctgaaatgaccgcattgaaacagcggttaaaaaagtacggcgcagaa
atcgctcaaatgtcaggtagcggtccaactgtgtttggtctttgtcagaagcattctcgg
gcgatgcgggtttacaacagcatgaagggattttgtcgtgaggtttatctgttgcggcca
ttttgcctgtcaacgaatagtcatcggctaaggggttga

DBGET integrated database retrieval system