KEGG   Lactobacillus rhamnosus Lc 705: LC705_02663Help
Entry
LC705_02663       CDS       T00990                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LC705_02663
Enzymes [BR:lrl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LC705_02663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2697768..2698496)
Genome map
AA seq 242 aa AA seqDB search
MTEQYVFENERKDLAEVAREMFVRKNTNVAGGNISVRITADKDIDYGSIHIKAGKDYLIM
TPTMMSEAWYAKLQPTQILVVDLETGKQIDGVGRLTREINMHEEAYRANDKIRCVYHSHA
EESMFWATAGLDMPNVTEVTEEVGPIRVLPYAPACSKELADTVYNGLKAVGDAAKEHIFL
LNSHGVLITSEDLHHATEILETVEWNAKIAYQQTVFMKLGLLDSYQSCGKASDGMLKEQV
QA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacagtatgtatttgaaaatgagcgtaaggatttggcagaagtagcgcgcgaa
atgtttgtgcgaaagaatacgaatgtcgctggtggcaatatcagcgttcgtattaccgcg
gataaagatattgattatggcagcattcatattaaggccggcaaagattatcttattatg
acacctaccatgatgtcagaagcttggtatgcgaagttacaaccgacccaaattctggtg
gttgatcttgagactggcaaacagattgatggggttggccgtttgacccgggaaatcaat
atgcatgaagaggcttatcgcgccaatgataagatccgttgcgtttaccattcacatgcc
gaagaatcaatgttttgggcaactgctggccttgatatgccaaatgttaccgaggtcact
gaagaagtcggaccgattcgcgtattaccctatgcaccggcttgctcaaaagaacttgcc
gacactgtctataatgggctcaaagcggtgggcgatgctgcaaaggaacacattttcttg
ttaaatagccacggcgttttgattacgtcggaagatttgcatcatgcaaccgagattctt
gagacggttgagtggaatgcaaaaattgcctatcagcaaacggtcttcatgaagctgggg
ctgctcgatagttatcagtcttgcggtaaagcgagtgatgggatgttgaaagaacaggta
caagcctga

DBGET integrated database retrieval system