KEGG   Lactobacillus rhamnosus Lc 705: LC705_02697Help
Entry
LC705_02697       CDS       T00990                                 

Gene name
galA
Definition
family 36 glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lrl00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:lrl00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:lrl00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2734367..2736487)
Genome map
AA seq 706 aa AA seqDB search
MTNFKTLKQYTFGDTILHYLINDAQVVEWMVYPKDMANQVVLRQNQNSGFSLIQAKLVQD
PYDKNFSNGLTMFNSATSRSIRFVKQEEHFSKDEEKITTICRDSHGNTYRHDVSWVPGSK
RLKVRVSFTNTSGHDQQLSWLPSIVLSNISPFYEQVPTGVLDLIRIRSKWAMEGRLDQRP
VESFELEESWKPSGLALVQIAQYGTMPVRQFFPYLGLKDNRFDVTWLIMLEGKASWQLNA
ARLDNRLVLFGGLPDADNGHWYKDVAVGETYTTPFAYITVGHDELLKCSRRLQAPVQEDT
LPIFYNEWGTTWGRPNAHLISESLPLLKQHSIDGYIIDAGWYKSKTSDWEQSHGDWQVDM
MRFPGGFKPVVEEIHQQGMEAGLWFEMETVGRLSEKFQDTESLVQRNGHVVTTLKRRFLN
MTNSNVQAYLNRHVLELLRQNAFDYLKIDYNDSMGVATDDAESGAEGLEKNISATLKFID
KLHHEIPGLVIENCSSGGHRLTPAFIERTELSSFSDAHETHSIPIIAANEWLVIPASKNL
IWCVLHADDTLEEMYFHLISTFLGRVCLSGDIRHLSTDQWHAVDQALTFYRANQRLIAHG
QPFRFGSSILSYRNPQGYQVCGFTDKETLDESGRLLLIVFGFNLSNSEDVDLRLSSHEWQ
VQDIVGAKKIGLQSDKTNWHGSIPANCYTAKAITFVRKREIEHFPA
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgacgaattttaagacgcttaagcaatataccttcggagatacaatcttacattacttg
attaacgatgctcaagtagttgaatggatggtctaccctaaagatatggcgaatcaagtt
gtgttacgtcagaaccaaaatagcggtttttctctcattcaggcgaaattggtccaggat
ccgtacgacaaaaacttctctaatggattaactatgttcaattcggcaacaagtcggagc
atacgctttgtaaaacaagaggagcactttagcaaggacgaagaaaaaatcacaacaatc
tgtcgagacagtcacggaaatacttatcgacatgatgtgtcttgggtaccaggatcaaaa
cggctaaaagtaagagtgtcatttactaatacttcagggcatgaccagcaattatcgtgg
ctaccttcaatagtgctaagcaatataagtcccttctatgaacaagtcccaactggtgta
ttggatcttatccgaattcgctcaaagtgggcgatggaggggcgtctggaccaaagacct
gttgaatcattcgaattggaggaaagttggaagccctctggtttggcgctagttcaaatt
gcccaatatggaacaatgcccgttcgtcaatttttcccatatttggggttaaaggacaat
agatttgatgtcacttggttaataatgctagagggaaaagcttcatggcagttgaatgcc
gcaagacttgataatcggttagttctttttggaggattacctgacgctgataacggacat
tggtataaagatgttgcagtaggagagacatacacaacaccttttgcctatattactgta
ggacacgatgaattacttaaatgtagtaggagattacaagcacctgtgcaagaggatacg
ttgccaatcttctacaatgaatgggggacaacttgggggcggccaaatgcccatttgatt
agtgaatcgttgcctctgcttaagcaacattcaatagatggttatatcattgacgctggc
tggtataagtcgaaaacatcggattgggagcaaagtcacggtgattggcaagttgacatg
atgcgttttcccggcggttttaagccagttgtggaagagattcatcagcagggtatggag
gcaggattatggtttgaaatggaaactgtcgggcgtttgagtgaaaaatttcaagatact
gagtctttggtgcaaagaaacgggcatgttgtaacaacattgaaacgccgctttttgaac
atgacaaattccaacgtacaggcctatctcaacagacatgttttggaacttctacgtcaa
aatgcgtttgattatttaaagattgactataacgacagtatgggtgtagcaactgatgac
gcggagtctggtgcagagggactagaaaaaaacatttcggcaacgctgaagtttattgat
aagttgcatcatgaaatacccgggcttgttattgagaattgttcttctggtgggcatcgt
ctgaccccagcatttattgagcgaacggaactatcctcattttcggatgcccacgaaaca
catagcattccaattattgctgctaacgagtggcttgttattccagcttccaaaaatttg
atttggtgcgtactacatgctgatgacacgcttgaagaaatgtattttcatctaattagc
acctttttaggacgcgtctgcctttcaggtgacattcggcatctgtcaacagatcaatgg
catgcggtagatcaagcgttgacattttatcgcgctaatcaaagattgattgctcatgga
caaccattccgttttggttcatcaatattaagttatcgtaatccacaagggtatcaagtt
tgtggtttcactgataaagaaacattggatgaaagcgggcgtctcttgctaatagtcttt
ggctttaatttgtcaaacagtgaagatgttgatttgcgtttatcgagtcatgagtggcag
gttcaagacatcgttggggcaaagaaaattggactgcagagcgacaaaacaaattggcac
ggatcaattccggcaaattgttatacagctaaagcaattacgtttgtacggaaaagagaa
attgaacatttcccagcttaa

DBGET integrated database retrieval system