KEGG   Lactobacillus rhamnosus Lc 705: pLC705_00050Help
Entry
pLC705_00050      CDS       T00990                                 

Gene name
lacM
Definition
beta-galactosidase, small subunit / lactase, small subunit
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    pLC705_00050 (lacM)
  Lipid metabolism
   00600 Sphingolipid metabolism
    pLC705_00050 (lacM)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    pLC705_00050 (lacM)
Enzymes [BR:lrl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     pLC705_00050 (lacM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pLC1:42275..43234
Genome map
AA seq 319 aa AA seqDB search
MAYTNNQLHVIYGDGSLGLQGANFHYLFSYERGGLESLVVNDKEWLYRTPTPIFWRATTD
NDHGSGFSVKSAQWYAADKFSTCQDIELTVDDQPVTPLPIAPLNNKYTDHEIATKVSLAY
HFVTTTVPSTIVTVTYTVTADGQINIATHYSGQSDLPELPAFGLRFIMPTTATGFDYTGL
SGETYPDRLAGATHGQFHVDSLPVTPYLVPQECGMHMQTEQVTVTRSTTQNNADHDNTPF
SLTFSQADAPFAFSCLPYTAAELENATHMEELPLARRTVLSIYGAVRGVGGIDSWGTDVE
APYHILADQDIDFSFNIHF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggcttacacaaataatcaactacacgttatttacggcgacgggagtttaggactacag
ggggctaatttccactacctctttagctacgaacgtggcggacttgaatcactcgtcgtc
aacgataaagagtggctctatcgtacacccacgcccatcttttggcgggcgacaaccgat
aatgatcacggtagcggcttttcagtcaaatccgcacagtggtacgcggccgataagttc
tcaacttgtcaagatatcgaattgacggttgacgaccaaccagtcacaccgttaccaatc
gcgccactcaataacaaatacacggatcacgaaatcgccacgaaagtctctctggcttac
cacttcgttaccacgaccgttcctagtaccatcgtcacagtgacttatacggtgacagca
gacggtcagatcaatatcgccacccattatagcggtcagtctgatttgccagagctaccc
gcatttggtctgcggtttatcatgccgactaccgcgaccggcttcgactataccggtttg
tccggtgagacttatcctgaccggctggctggcgcaacacacgggcaattccacgttgac
agtctgccagtcacaccatacttggtcccacaagaatgcggcatgcacatgcaaactgaa
caagtgacagtaacgcgatcaaccacacaaaataacgctgaccacgacaacacaccattc
agtttgacatttagccaagccgatgcaccattcgccttcagctgccttccctataccgct
gctgaactagaaaacgcaacacacatggaagaattaccattagcacggcgaacggtctta
tcaatctacggtgccgttcgtggggtcggtggcattgatagttggggaacggacgtagaa
gccccatatcatatcctcgctgatcaagacattgacttcagctttaacattcatttctaa

DBGET integrated database retrieval system