KEGG   Lactobacillus rhamnosus Lc 705: pLC705_00073Help
Entry
pLC705_00073      CDS       T00990                                 

Gene name
nag
Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lrl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    pLC705_00073 (nag)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    pLC705_00073 (nag)
Enzymes [BR:lrl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     pLC705_00073 (nag)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pLC1:complement(58908..60833)
Genome map
AA seq 641 aa AA seqDB search
MKKLTRIIFCVISCVSLIASSIGLYSTPKIVKADTTSVTDADINAYISNMTLDQKIGQMF
VSRTLQDTDKARSDIAKYNLGGLIVYGADFTSVEGKTATEAQNNFKMKVQSFQNSASLPL
LIGVDQEGGTVSRLSQNPLIANGRSFPSPQTAYANGGMANVTKEASEVGTILKNLGINWN
YAPVADSTPDTSSFIYGRTFGQDYLATANYITNVIPAWQNAGVAATLKHFPGYGSAIDTH
TDFAVVTKSKADFEKEDLLPFKSGITAGADSVMIAHIVMQAVDPVYPASLSRKVVTDLLR
NELGYNGLIITDALEMGAIKQFAQEHDQVPVDVLAVEAGNDCIMNNDYETAIPQIHAAVT
SGTIKESEINEHVFRILDLKRKLGLLTKAQLQQKKVQIDNVSYSSDNKKATVSGTVVDSD
WQVGEPLSVKDSTGKVIITADVGAGGKFTFDIPTNSQEQVLTLTTNLPNIADAKITIKAV
SSSNTNKTLLENLIKSVEKLASNQYTVKSWQELQAKLTESKSILNNDSATQDQVDASVNA
LQSALKQLVSASNSENNSQNSNDSSSQSSSNTGGQASSSTSNANETNIASKDLSGTKSDK
GSKDNHGFLPSTGERVMAGISVLGVILIACVTVLYIRKKRA
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctgacaaggattattttttgcgttattagttgtgttagcctaatagccagt
tcaataggactctattcaactccaaaaatcgtaaaagctgatactacatcagtgaccgat
gccgatattaatgcctatatttctaatatgaccttagatcaaaagattggacaaatgttt
gtgtctcgaacattgcaagatacggataaagctcgatctgatatagcaaaatacaacctt
ggtgggttgattgtatatggagctgatttcactagtgttgaaggaaaaacagctaccgaa
gcacagaataatttcaagatgaaggtgcaaagttttcaaaactcagcaagcctgccgtta
ttgattggtgttgatcaagagggaggaacagtttcacgcttatcacaaaatcctctaatt
gcgaatggtagaagctttccttcaccacaaacggcttatgctaatggcggaatggccaat
gtaacaaaagaggctagtgaagtcggaactattctaaaaaatctgggcatcaattggaac
tatgcaccagtagctgacagcacgcctgatacttctagttttatttatggcagaactttt
ggtcaagattacttggcaactgcaaactatattacgaatgtgatccctgcatggcagaat
gctggtgttgcagcaacgcttaaacattttccgggttacggatcagcgattgatacgcat
acggattttgcagttgttacaaaatctaaggcggattttgaaaaagaggatttgcttccc
tttaaatccggtattacagcaggagcagattcagtaatgattgcacatatcgtaatgcaa
gctgttgacccagtatacccagcttcattatcacgaaaggtcgttacagacttgttgcgt
aatgaacttggttataatggcttaatcattaccgatgcattggaaatgggagctatcaag
caatttgctcaagaacatgatcaagttcctgttgatgttcttgctgttgaagcaggaaat
gattgcatcatgaataatgattatgaaaccgctattccacagattcatgcagcagtaact
agcggcactattaaggaatcagaaatcaatgaacacgttttccgcattctagatctcaaa
cgcaagttagggctgttaactaaagcgcaacttcagcaaaaaaaggttcagattgacaat
gtttcctacagcagtgacaacaaaaaggcaacagttagcggcacagttgttgatagtgat
tggcaagttggagaaccgttatcggttaaagactcaactggaaaggtcattattaccgca
gacgtcggggccggtggtaagtttactttcgatattcctactaattcccaagaacaagta
ttaactctgaccactaatctacccaatatcgctgatgccaaaataactattaaggctgtg
agttcatcgaatactaacaaaactttgctagaaaacttgattaaatctgttgaaaaatta
gctagcaatcaatatactgtcaagtcttggcaagagttgcaagctaaactaactgaatca
aaatcaattttaaacaatgatagtgctacacaagatcaagtagatgcttccgttaatgct
ttgcaaagtgcccttaagcaattagtttctgcatcaaatagcgaaaataatagtcaaaac
tctaatgatagcagttcccaaagttcatctaacactggtggacaagcatcatccagtact
agtaatgctaatgagactaatattgctagtaaggatttgtcaggtacaaagtcggataaa
ggatctaaggacaatcacggttttttgccaagtacgggtgaacgcgtgatggcaggaatt
tctgttctgggggtaattttaatagcttgcgtgactgtattatatattcgaaaaaaaagg
gcataa

DBGET integrated database retrieval system