KEGG   Lactobacillus rhamnosus Lc 705: pLC705_00073Help
Entry
pLC705_00073      CDS       T00990                                 

Gene name
nag
Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lrl00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lrl00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pLC1:complement(58908..60833)
Genome map
AA seq 641 aa AA seqDB search
MKKLTRIIFCVISCVSLIASSIGLYSTPKIVKADTTSVTDADINAYISNMTLDQKIGQMF
VSRTLQDTDKARSDIAKYNLGGLIVYGADFTSVEGKTATEAQNNFKMKVQSFQNSASLPL
LIGVDQEGGTVSRLSQNPLIANGRSFPSPQTAYANGGMANVTKEASEVGTILKNLGINWN
YAPVADSTPDTSSFIYGRTFGQDYLATANYITNVIPAWQNAGVAATLKHFPGYGSAIDTH
TDFAVVTKSKADFEKEDLLPFKSGITAGADSVMIAHIVMQAVDPVYPASLSRKVVTDLLR
NELGYNGLIITDALEMGAIKQFAQEHDQVPVDVLAVEAGNDCIMNNDYETAIPQIHAAVT
SGTIKESEINEHVFRILDLKRKLGLLTKAQLQQKKVQIDNVSYSSDNKKATVSGTVVDSD
WQVGEPLSVKDSTGKVIITADVGAGGKFTFDIPTNSQEQVLTLTTNLPNIADAKITIKAV
SSSNTNKTLLENLIKSVEKLASNQYTVKSWQELQAKLTESKSILNNDSATQDQVDASVNA
LQSALKQLVSASNSENNSQNSNDSSSQSSSNTGGQASSSTSNANETNIASKDLSGTKSDK
GSKDNHGFLPSTGERVMAGISVLGVILIACVTVLYIRKKRA
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctgacaaggattattttttgcgttattagttgtgttagcctaatagccagt
tcaataggactctattcaactccaaaaatcgtaaaagctgatactacatcagtgaccgat
gccgatattaatgcctatatttctaatatgaccttagatcaaaagattggacaaatgttt
gtgtctcgaacattgcaagatacggataaagctcgatctgatatagcaaaatacaacctt
ggtgggttgattgtatatggagctgatttcactagtgttgaaggaaaaacagctaccgaa
gcacagaataatttcaagatgaaggtgcaaagttttcaaaactcagcaagcctgccgtta
ttgattggtgttgatcaagagggaggaacagtttcacgcttatcacaaaatcctctaatt
gcgaatggtagaagctttccttcaccacaaacggcttatgctaatggcggaatggccaat
gtaacaaaagaggctagtgaagtcggaactattctaaaaaatctgggcatcaattggaac
tatgcaccagtagctgacagcacgcctgatacttctagttttatttatggcagaactttt
ggtcaagattacttggcaactgcaaactatattacgaatgtgatccctgcatggcagaat
gctggtgttgcagcaacgcttaaacattttccgggttacggatcagcgattgatacgcat
acggattttgcagttgttacaaaatctaaggcggattttgaaaaagaggatttgcttccc
tttaaatccggtattacagcaggagcagattcagtaatgattgcacatatcgtaatgcaa
gctgttgacccagtatacccagcttcattatcacgaaaggtcgttacagacttgttgcgt
aatgaacttggttataatggcttaatcattaccgatgcattggaaatgggagctatcaag
caatttgctcaagaacatgatcaagttcctgttgatgttcttgctgttgaagcaggaaat
gattgcatcatgaataatgattatgaaaccgctattccacagattcatgcagcagtaact
agcggcactattaaggaatcagaaatcaatgaacacgttttccgcattctagatctcaaa
cgcaagttagggctgttaactaaagcgcaacttcagcaaaaaaaggttcagattgacaat
gtttcctacagcagtgacaacaaaaaggcaacagttagcggcacagttgttgatagtgat
tggcaagttggagaaccgttatcggttaaagactcaactggaaaggtcattattaccgca
gacgtcggggccggtggtaagtttactttcgatattcctactaattcccaagaacaagta
ttaactctgaccactaatctacccaatatcgctgatgccaaaataactattaaggctgtg
agttcatcgaatactaacaaaactttgctagaaaacttgattaaatctgttgaaaaatta
gctagcaatcaatatactgtcaagtcttggcaagagttgcaagctaaactaactgaatca
aaatcaattttaaacaatgatagtgctacacaagatcaagtagatgcttccgttaatgct
ttgcaaagtgcccttaagcaattagtttctgcatcaaatagcgaaaataatagtcaaaac
tctaatgatagcagttcccaaagttcatctaacactggtggacaagcatcatccagtact
agtaatgctaatgagactaatattgctagtaaggatttgtcaggtacaaagtcggataaa
ggatctaaggacaatcacggttttttgccaagtacgggtgaacgcgtgatggcaggaatt
tctgttctgggggtaattttaatagcttgcgtgactgtattatatattcgaaaaaaaagg
gcataa

DBGET integrated database retrieval system