KEGG   Lactobacillus ruminis: LRC_01140Help
Entry
LRC_01140         CDS       T01626                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
lrm  Lactobacillus ruminis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:lrm00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:lrm00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
128275..128883
Genome map
AA seq 202 aa AA seqDB search
MGQINVEKNVGGIEGLCVITPAVHGDDRGYFMETYNENDMKEAGIDVKFVQDNQSMSTKG
VLRGLHFQKHFPQCKLVRAVRGTVFDAVVDLRQDSKTYGKWYGVTLSAENKKQFLIPEGF
AHGFLVLSDEAEFCYKVNDFWHPNDEGGMAWNDPEIGIEWPELVGEYKGTPSAEGYTLED
GTKITLSDKDQKWLGFKDTFKF
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaatcaatgttgaaaaaaacgtcggcggaatcgaaggcctttgcgtcatcacg
ccggcagtccacggtgacgatcgcggatactttatggaaacgtacaatgaaaacgacatg
aaggaagcaggcatcgacgtgaagttcgtgcaagataaccagtcgatgtcgaccaaaggc
gtgctgagaggactgcatttccaaaagcacttcccgcaatgcaagctcgtgcgagccgtt
cgcggaactgtgtttgatgcggtcgtcgatcttcgtcaggattcgaagacgtacggcaag
tggtacggcgtgacgctttcagccgaaaacaagaagcagttcttgatccccgaaggcttt
gcgcatggtttcctcgttttgagcgatgaagcggaattctgttacaaggtcaatgacttc
tggcatccaaacgatgaaggcggcatggcctggaacgatcccgaaatcgggatagagtgg
ccggaacttgtcggtgagtacaaaggtactccgtccgctgaaggctacacgcttgaagac
ggcacgaagatcactctgtccgacaaagatcagaagtggctcggattcaaggacacgttc
aagttttag

DBGET integrated database retrieval system