KEGG   Lactobacillus ruminis: LRC_01820Help
Entry
LRC_01820         CDS       T01626                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lrm  Lactobacillus ruminis
Pathway
lrm00230  Purine metabolism
lrm01100  Metabolic pathways
Module
lrm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LRC_01820 (gmk)
Enzymes [BR:lrm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LRC_01820 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 PRK KTI12 AAA_25 ADK Zeta_toxin AAA_17 AAA_28 MMR_HSR1 ABC_tran AAA_24 AAA_19 AAA_16 AAA DUF421 RNA_helicase AAA_30 RuvB_N Cys_Met_Meta_PP Viral_helicase1 cobW CPT
Motif
Other DBs
NCBI-ProteinID: AEN77510
UniProt: G2SQG1
Position
204649..205218
Genome map
AA seq 189 aa AA seqDB search
MENKVIVLCGAPGSGKTTVRKYLTENFAIEPVLTHTTRLKRKGEHDGIDYWFETRETFFK
NHYLEYVEYDGNLYGSSYESLERAWQRAPVATIVLDTKGAETYLERIPEKTEVVYLCVTD
EKVQRERMEQRGDDADKIQRRLASQEAKRDKHLPDKLVKHVHVIENDDWEETKVKIQTLL
QMLGIETTC
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaaagtaattgttttatgcggtgctccgggcagcggcaaaacgaccgtccgc
aaatatctgacggaaaattttgcaattgaaccggttttgacgcatacgaccaggctaaaa
cggaagggcgagcacgacggaatcgactactggtttgaaacgcgtgaaactttttttaaa
aatcactatttggaatatgtcgaatatgacggcaatctgtacggatcgtcttatgaaagt
ttggaacgtgcctggcaaagggctccggttgcgacgatcgttcttgatacaaagggtgcg
gaaacgtacctggaacggatacccgaaaaaacggaggtcgtctatctttgcgtgaccgat
gaaaaagttcaaagagaacgcatggagcaacgcggagacgatgctgacaaaatacagcgc
aggcttgcttcgcaggaagcaaagcgcgacaagcacttgcccgacaagcttgttaagcat
gtgcatgtcatcgaaaacgatgactgggaagaaaccaaggtcaaaatccagactctgcta
caaatgttgggaatcgaaacaacttgttga

DBGET integrated database retrieval system