KEGG   Lactobacillus ruminis: LRC_01820Help
Entry
LRC_01820         CDS       T01626                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lrm  Lactobacillus ruminis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lrm00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
204649..205218
Genome map
AA seq 189 aa AA seqDB search
MENKVIVLCGAPGSGKTTVRKYLTENFAIEPVLTHTTRLKRKGEHDGIDYWFETRETFFK
NHYLEYVEYDGNLYGSSYESLERAWQRAPVATIVLDTKGAETYLERIPEKTEVVYLCVTD
EKVQRERMEQRGDDADKIQRRLASQEAKRDKHLPDKLVKHVHVIENDDWEETKVKIQTLL
QMLGIETTC
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggagaacaaagtaattgttttatgcggtgctccgggcagcggcaaaacgaccgtccgc
aaatatctgacggaaaattttgcaattgaaccggttttgacgcatacgaccaggctaaaa
cggaagggcgagcacgacggaatcgactactggtttgaaacgcgtgaaactttttttaaa
aatcactatttggaatatgtcgaatatgacggcaatctgtacggatcgtcttatgaaagt
ttggaacgtgcctggcaaagggctccggttgcgacgatcgttcttgatacaaagggtgcg
gaaacgtacctggaacggatacccgaaaaaacggaggtcgtctatctttgcgtgaccgat
gaaaaagttcaaagagaacgcatggagcaacgcggagacgatgctgacaaaatacagcgc
aggcttgcttcgcaggaagcaaagcgcgacaagcacttgcccgacaagcttgttaagcat
gtgcatgtcatcgaaaacgatgactgggaagaaaccaaggtcaaaatccagactctgcta
caaatgttgggaatcgaaacaacttgttga

DBGET integrated database retrieval system