KEGG   Lactobacillus ruminis: LRC_01990Help
Entry
LRC_01990         CDS       T01626                                 

Gene name
proB
Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lrm  Lactobacillus ruminis
Pathway
lrm00330  Arginine and proline metabolism
lrm00332  Carbapenem biosynthesis
lrm01100  Metabolic pathways
lrm01130  Biosynthesis of antibiotics
lrm01230  Biosynthesis of amino acids
Module
lrm_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LRC_01990 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    LRC_01990 (proB)
Enzymes [BR:lrm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LRC_01990 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: AEN77526
UniProt: G2SQH7
Position
221701..222507
Genome map
AA seq 268 aa AA seqDB search
MSSKRQLDGAKRIVVKVGTSTLIHPNGRINLQAIDQLSFSLSGLVNEGKQVVLVSSGAIG
VGMGQMGLDARPEKIPEQQALASMGQCELMTIYQQRFTTYGQKISQVLLTHDVLDYPESR
QNVFNTLDTLLEWGIIPIINENDTIAVDELDHHTKFGDNDQLSAVVADIVDADLLIMLSD
IDGFFNKNPRHFKDARLIDEINKIDSKVIEQAGGKGTKFGTGGMTTKLKAAKRILKHDRM
MILANGENPSIIFRIMNGDKIGTLFRKK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaagcgccaacttgacggtgcaaaacgaatcgttgtcaaggtcggaaccagc
acgctgattcatccgaatggcaggatcaatctgcaggcaatcgatcagctcagcttttcg
ttgagcggtcttgtcaacgaaggcaagcaggtcgtccttgtttcatcaggggcaatcggc
gtcggaatgggacagatggggttggatgctcgacccgagaagattccggaacaacaagcc
ttggcatcaatggggcagtgcgaactgatgacgatttaccagcagcgttttacgacgtat
ggtcaaaagatcagccaagtgctgctgacgcatgacgtcttggactatccggagagtcgc
cagaacgtttttaacacgcttgatacgctgcttgaatggggcattattccgattatcaac
gaaaatgacacgattgcagtcgacgaactcgatcaccacacgaagttcggcgacaacgat
cagctttcagctgtcgtggccgacatcgtcgatgcggatcttttgatcatgctgtcagac
attgacggatttttcaacaaaaatccgcgccatttcaaagacgccaggctgattgacgaa
atcaacaagattgactccaaggttatcgaacaggccggcggcaagggaactaaattcgga
acgggcggaatgacgaccaagctcaaggcggcaaaacgcattttgaagcatgatcgcatg
atgattcttgcgaacggtgaaaatccgtcgattattttcagaatcatgaacggtgataag
atcggaactcttttcaggaaaaaatga

DBGET integrated database retrieval system