KEGG   Lactobacillus ruminis: LRC_02290Help
Entry
LRC_02290         CDS       T01626                                 

Gene name
bgl
Definition
Beta glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lrm  Lactobacillus ruminis
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRC_02290 (bgl)
Enzymes [BR:lrm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LRC_02290 (bgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
250009..251403
Genome map
AA seq 464 aa AA seqDB search
MLKFPSDFAWGAATSGPQSEGTFKKKHQNVFDYWYANDPDKFYDGVGPDTASNFFNDYKE
DLALMRKAGIKSLRTSIQWSRLIDDFEKCTVNQDAVDFYNNVINAMLENGIEPYMNLCHF
DMPVELQHKYGGFESKHVTDLYAGFAEQCFKLFGDRVKNWFTFNEPKVILDGAYLYQFHY
PLKVDGPLSVQVAYNINLASAKTIERFRKLYGNDDDKRIGIILNLTPAYSASDSKEDKEA
AEFAELWANKMFLDPAILGCYPEKLVEILKRDGVLWDYTQEELDLIAKETIDVLGVNYYH
PFRVKAPEVSSKSLQDWMPDIYFDEYEMPGRVMNVDKGWEIFPEALYDIAINVRDNYKNI
PWFVSENGMGVSREERFMDENGVVHDDYRINFMKNHLKELHRGIEEGSNCHGYFVWTGID
CWSWMNAYRNRYGLIRDDIHTQIKTIKDSGRWFKETSDNNGFEE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaatttccaagtgattttgcgtggggtgccgcaacgtcaggcccccaatccgaa
ggtactttcaaaaagaagcaccaaaacgtttttgattattggtatgccaatgatccggat
aaattttatgacggagtaggtcctgataccgcatcgaattttttcaacgattataaagaa
gaccttgctctcatgcgcaaggccggcatcaagtcattgcggacgtccattcaatggagc
cgcttgattgatgattttgaaaaatgcacggtaaatcaggatgcggtcgatttttacaac
aacgtgatcaatgcgatgctcgaaaacggcattgaaccatacatgaatctttgccacttt
gacatgcctgtcgaattgcagcataaatacggcggatttgaatcaaagcacgtcacggat
ttgtatgccggttttgctgaacaatgcttcaagctctttggcgatcgcgtcaagaactgg
tttacgttcaacgaaccaaaggttatcctggatggtgcatatttgtatcaattccattat
ccgttgaaagttgacggtcctctttcagtgcaggtcgcatataacatcaaccttgcttct
gccaaaacaattgaacgtttccgcaagctttacggaaatgatgacgacaagcgtatcggc
attatcttgaatcttacgcccgcatattctgcatccgactctaaagaagataaggaagca
gctgaattcgcagaactttgggcaaacaagatgttcctggatccggctattttgggatgc
tatcctgaaaagcttgttgaaattttgaagcgtgacggtgttttgtgggattatactcaa
gaagaactcgatttgattgccaaagaaaccatcgacgttttaggcgtcaactactaccat
ccgttccgcgtcaaggcgcctgaagtatcatccaagagtttgcaggactggatgcctgac
atctactttgatgaatatgagatgcctggtcgcgtcatgaacgttgacaaaggctgggaa
attttcccggaagcattgtatgacattgcaatcaacgttcgcgacaattacaaaaacatt
ccttggttcgtttcagaaaacggcatgggtgtttctcgcgaagagcgttttatggatgaa
aatggtgtagttcatgacgattatcgcatcaatttcatgaagaatcacttgaaagaactt
catcgcggaatcgaagaaggttcaaactgccatggctactttgtttggacgggcattgac
tgctggtcgtggatgaatgcatatcgcaatcgttatggccttattcgtgacgatattcat
acgcaaatcaagacgatcaaggattcaggtcgttggttcaaagagacaagcgataataac
ggttttgaagaatag

DBGET integrated database retrieval system