KEGG   Lactobacillus ruminis: LRC_03100Help
Entry
LRC_03100         CDS       T01626                                 

Definition
Lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
lrm  Lactobacillus ruminis
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:lrm00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
325735..326685
Genome map
AA seq 316 aa AA seqDB search
MVPFKDEDCERFMEQEVKPWIEENVTDFAFDSYDGKKLQAYCAIPEKPKKALVFVHGFCE
FFGKYHELFYDFYHAGYAVFFYEQRGFGKSFREVSDKDAVYVGNFDEYVEDLKLFTDEVS
KMMEKKLDLMLFAHSMGGCVGALYLEKYPETFKKAVLSSPMMRMALEPRLKKVARPLCLV
QKALHRAKRLAIGQERFDERPDFKNSCALSEARYSYQFKQRLKNAEYQTNGATYSWVLAA
LNAEKQLMQNAGRIKCPVLLCSSGNDAMVDVSGQTEFAEKSRFVRLKQFPEAKHELFNCS
AEILEEYYATLLKFYE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggttccgttcaaggacgaggactgtgaacgttttatggagcaggaagtcaagccgtgg
attgaagaaaacgtcacggattttgcgtttgacagctatgacggaaaaaagcttcaagca
tactgtgcgattccggaaaaaccaaaaaaagcgcttgttttcgtgcatggtttttgcgaa
ttttttggcaagtatcacgagctgttttacgatttttatcatgcgggatatgccgtgttc
ttctatgagcagcgaggattcgggaagtcttttcgcgaagtttcggacaaggatgcggtt
tacgtcggaaattttgacgagtatgtcgaagacttgaaattgtttaccgatgaggtttcc
aaaatgatggaaaaaaagcttgatttgatgttgtttgcgcactcgatgggcggctgcgtc
ggtgcgctgtatttggaaaaatacccggaaacgttcaaaaaagcagtgctgagctcgccg
atgatgaggatggcacttgagccgcggttaaaaaaggtcgccaggccgctctgcctggtg
caaaaagctcttcatcgcgccaagcgactggcaatcggacaggaaagattcgacgaacgg
cctgatttcaagaacagctgcgcgttgtccgaggcgcgctattcgtatcagttcaagcag
cgcctgaaaaatgcagagtatcaaacgaacggcgcaacctattcatgggttttggcagcg
ttgaacgcggaaaaacagctcatgcaaaatgcaggcaggatcaaatgtcccgtgctgctt
tgttcgtcaggaaacgatgcgatggttgacgtttcgggacaaacggaatttgccgagaaa
agcagattcgtcagactcaagcagtttcctgaagcaaagcacgaattgttcaactgttcg
gctgaaattctggaagaatactatgcgactttgctgaaattttacgaataa

DBGET integrated database retrieval system