KEGG   Lactobacillus ruminis: LRC_03380Help
Entry
LRC_03380         CDS       T01626                                 

Gene name
alr
Definition
alanine racemase
Orthology
K01775  
alanine racemase [EC:5.1.1.1]
Organism
lrm  Lactobacillus ruminis
Pathway
D-Alanine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LRC_03380 (alr)
Enzymes [BR:lrm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     LRC_03380 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
361023..362147
Genome map
AA seq 374 aa AA seqDB search
MVVGIHRNAKAVIDLDAIKHNIEIEKKRMRDDQKLFAVVKANAYGHGMIEVARTAKEAGA
NGFCVAIIDEGIELRNAGFDDLVLILGVCPAEQSNVIAANNLSVAVGDLDFLENAKPLLK
AQGLKLKVHLAFDTGMGRIGFVNGEKVHEAEAFMKENSDQFEFEGIFTHFACADTKDDSY
YKKQLEKFNELKDALDDLPPYVHVANSAASMWHDDCGGNAVRYGITMYGLNPSGRELELP
CEIKPAFTLESELVSVRLLEPGTGIGYGKTYTVDEPQWIGTVPLGYADGWLRRMQGFKVL
INGEYCQSVGRVCMDQFMVRLPYEMEKGTKVTLIGENGGKRITAQDVADYADTIHYEILC
SVSERVPREFIKKY
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggttgttggaattcatcgcaatgccaaggccgtgattgaccttgatgctataaaacac
aatattgaaattgaaaagaagcggatgcgtgacgatcagaagctgtttgccgtggtgaaa
gcaaatgcttacggacatggaatgattgaggttgccaggacggccaaagaagctggtgca
aacggcttttgcgtggcaatcatcgatgagggcatcgaactcagaaatgcagggtttgat
gatttggttttgattcttggcgtttgtccggctgaacagtcaaatgtgattgctgcaaac
aatctttcggttgccgtcggagatctggattttcttgaaaatgcaaaaccgctgttaaaa
gcgcaagggctgaagcttaaagttcatctggcatttgataccgggatgggaagaatcgga
ttcgtcaatggagaaaaagttcatgaagcagaagcattcatgaaggaaaacagcgatcag
ttcgaatttgagggaatttttacgcacttcgcctgtgcagatacgaaagatgattcgtat
tataaaaagcagcttgaaaaattcaatgagttgaaggatgcgttggatgatttgccgcct
tacgttcatgttgcaaattccgcagcctcgatgtggcatgatgattgcggcggaaatgcc
gttcgttacgggattacgatgtatggcctcaatccgtccgggagagagttggaacttcct
tgtgaaatcaagcctgcttttacgcttgaaagcgagcttgtttcggtaaggctgcttgaa
ccgggaacaggcattgggtacggcaaaacatacaccgttgacgagccgcaatggatcggg
accgttccgctcgggtatgccgatggttggctaagacgcatgcaagggttcaaggttttg
atcaatggcgaatattgtcaaagtgtcggacgtgtatgtatggaccaatttatggtaaga
ttaccctatgagatggaaaaaggaacgaaggtgacgctgatcggcgaaaacggaggcaag
cgcattaccgcgcaggacgttgccgattatgccgacacgatacattatgaaattctttgc
tccgtttcagaaagggttccaagggaatttattaagaaatattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system