KEGG   Lactobacillus ruminis: LRC_03380Help
Entry
LRC_03380         CDS       T01626                                 

Gene name
alr
Definition
alanine racemase
Orthology
K01775  
alanine racemase [EC:5.1.1.1]
Organism
lrm  Lactobacillus ruminis
Pathway
D-Alanine metabolism
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; D-Alanine metabolism [PATH:lrm00473]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
361023..362147
Genome map
AA seq 374 aa AA seqDB search
MVVGIHRNAKAVIDLDAIKHNIEIEKKRMRDDQKLFAVVKANAYGHGMIEVARTAKEAGA
NGFCVAIIDEGIELRNAGFDDLVLILGVCPAEQSNVIAANNLSVAVGDLDFLENAKPLLK
AQGLKLKVHLAFDTGMGRIGFVNGEKVHEAEAFMKENSDQFEFEGIFTHFACADTKDDSY
YKKQLEKFNELKDALDDLPPYVHVANSAASMWHDDCGGNAVRYGITMYGLNPSGRELELP
CEIKPAFTLESELVSVRLLEPGTGIGYGKTYTVDEPQWIGTVPLGYADGWLRRMQGFKVL
INGEYCQSVGRVCMDQFMVRLPYEMEKGTKVTLIGENGGKRITAQDVADYADTIHYEILC
SVSERVPREFIKKY
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggttgttggaattcatcgcaatgccaaggccgtgattgaccttgatgctataaaacac
aatattgaaattgaaaagaagcggatgcgtgacgatcagaagctgtttgccgtggtgaaa
gcaaatgcttacggacatggaatgattgaggttgccaggacggccaaagaagctggtgca
aacggcttttgcgtggcaatcatcgatgagggcatcgaactcagaaatgcagggtttgat
gatttggttttgattcttggcgtttgtccggctgaacagtcaaatgtgattgctgcaaac
aatctttcggttgccgtcggagatctggattttcttgaaaatgcaaaaccgctgttaaaa
gcgcaagggctgaagcttaaagttcatctggcatttgataccgggatgggaagaatcgga
ttcgtcaatggagaaaaagttcatgaagcagaagcattcatgaaggaaaacagcgatcag
ttcgaatttgagggaatttttacgcacttcgcctgtgcagatacgaaagatgattcgtat
tataaaaagcagcttgaaaaattcaatgagttgaaggatgcgttggatgatttgccgcct
tacgttcatgttgcaaattccgcagcctcgatgtggcatgatgattgcggcggaaatgcc
gttcgttacgggattacgatgtatggcctcaatccgtccgggagagagttggaacttcct
tgtgaaatcaagcctgcttttacgcttgaaagcgagcttgtttcggtaaggctgcttgaa
ccgggaacaggcattgggtacggcaaaacatacaccgttgacgagccgcaatggatcggg
accgttccgctcgggtatgccgatggttggctaagacgcatgcaagggttcaaggttttg
atcaatggcgaatattgtcaaagtgtcggacgtgtatgtatggaccaatttatggtaaga
ttaccctatgagatggaaaaaggaacgaaggtgacgctgatcggcgaaaacggaggcaag
cgcattaccgcgcaggacgttgccgattatgccgacacgatacattatgaaattctttgc
tccgtttcagaaagggttccaagggaatttattaagaaatattaa

DBGET integrated database retrieval system