KEGG   Lactobacillus ruminis: LRC_03920Help
Entry
LRC_03920         CDS       T01626                                 

Gene name
pgm
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lrm  Lactobacillus ruminis
Pathway
lrm00010  Glycolysis / Gluconeogenesis
lrm00260  Glycine, serine and threonine metabolism
lrm00680  Methane metabolism
lrm01100  Metabolic pathways
lrm01110  Biosynthesis of secondary metabolites
lrm01120  Microbial metabolism in diverse environments
lrm01130  Biosynthesis of antibiotics
lrm01200  Carbon metabolism
lrm01230  Biosynthesis of amino acids
Module
lrm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lrm_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRC_03920 (pgm)
  Energy metabolism
   00680 Methane metabolism
    LRC_03920 (pgm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LRC_03920 (pgm)
Enzymes [BR:lrm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LRC_03920 (pgm)
Membrane trafficking [BR:lrm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LRC_03920 (pgm)
Exosome [BR:lrm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LRC_03920 (pgm)
  Exosomal proteins of melanoma cells
   LRC_03920 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEN77707
UniProt: G2SRP2
Position
419317..419988
Genome map
AA seq 223 aa AA seqDB search
MVKLVLIRHGQSIANKEDVYTGWSDSPLTRKGISQARHAGKLLFHEKINFSDVHTSVLVR
AIKTANIVLDEIGQSYLPIHKTWRLNERHYGALRGLNKKRTREIYGEEQVALWRRSFYTV
PPLLEKIDHDRRYDCFPDVVVPRGESLKMAYDRIVPYWTDGIAPKLLNGENQLVVAHGST
LRAMIKFIEHISDQGIDGVEVANGTPIIYELDHRLKIVEKKIL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagttggttttaatcagacacgggcaaagcattgccaataaagaagacgtttat
acgggatggtccgactctccgctgacaagaaaaggcatcagtcaagcgcgacatgcgggc
aagttgctgtttcatgaaaaaatcaacttttcggacgtgcacacttccgttttggtgcgc
gcaatcaagaccgcaaacatcgttttggatgaaatcggacaaagctatttgccgattcat
aaaacgtggcgcttgaacgagcgacattacggggcattgcgcggcttaaacaaaaagaga
acgcgcgaaatatacggtgaagaacaggttgcgttatggcgtcgttcattttatacggtg
ccgccgctattggaaaaaattgatcacgacaggcgatacgattgttttcctgatgtcgtc
gtgccgcgcggcgaaagcttgaagatggcttatgacagaatcgtgccttactggacggat
ggaattgcaccgaaattgcttaacggagaaaaccagcttgtcgtggctcacgggagcact
ctgcgcgcgatgatcaagttcattgagcacatcagcgatcagggaatagatggcgtcgag
gttgcaaacggaacaccgataatttatgaactcgaccatcgattgaaaatcgtcgaaaag
aaaattttatag

DBGET integrated database retrieval system