KEGG   Lactobacillus ruminis: LRC_03920Help
Entry
LRC_03920         CDS       T01626                                 

Gene name
pgm
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lrm  Lactobacillus ruminis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LRC_03920 (pgm)
   01230 Biosynthesis of amino acids
    LRC_03920 (pgm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRC_03920 (pgm)
  Energy metabolism
   00680 Methane metabolism
    LRC_03920 (pgm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LRC_03920 (pgm)
Enzymes [BR:lrm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LRC_03920 (pgm)
Exosome [BR:lrm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LRC_03920 (pgm)
  Exosomal proteins of melanoma cells
   LRC_03920 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
419317..419988
Genome map
AA seq 223 aa AA seqDB search
MVKLVLIRHGQSIANKEDVYTGWSDSPLTRKGISQARHAGKLLFHEKINFSDVHTSVLVR
AIKTANIVLDEIGQSYLPIHKTWRLNERHYGALRGLNKKRTREIYGEEQVALWRRSFYTV
PPLLEKIDHDRRYDCFPDVVVPRGESLKMAYDRIVPYWTDGIAPKLLNGENQLVVAHGST
LRAMIKFIEHISDQGIDGVEVANGTPIIYELDHRLKIVEKKIL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagttggttttaatcagacacgggcaaagcattgccaataaagaagacgtttat
acgggatggtccgactctccgctgacaagaaaaggcatcagtcaagcgcgacatgcgggc
aagttgctgtttcatgaaaaaatcaacttttcggacgtgcacacttccgttttggtgcgc
gcaatcaagaccgcaaacatcgttttggatgaaatcggacaaagctatttgccgattcat
aaaacgtggcgcttgaacgagcgacattacggggcattgcgcggcttaaacaaaaagaga
acgcgcgaaatatacggtgaagaacaggttgcgttatggcgtcgttcattttatacggtg
ccgccgctattggaaaaaattgatcacgacaggcgatacgattgttttcctgatgtcgtc
gtgccgcgcggcgaaagcttgaagatggcttatgacagaatcgtgccttactggacggat
ggaattgcaccgaaattgcttaacggagaaaaccagcttgtcgtggctcacgggagcact
ctgcgcgcgatgatcaagttcattgagcacatcagcgatcagggaatagatggcgtcgag
gttgcaaacggaacaccgataatttatgaactcgaccatcgattgaaaatcgtcgaaaag
aaaattttatag

DBGET integrated database retrieval system