KEGG   Lactobacillus ruminis: LRC_03920Help
Entry
LRC_03920         CDS       T01626                                 

Gene name
pgm
Definition
(RefSeq) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lrm  Lactobacillus ruminis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LRC_03920 (pgm)
   01230 Biosynthesis of amino acids
    LRC_03920 (pgm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRC_03920 (pgm)
  Energy metabolism
   00680 Methane metabolism
    LRC_03920 (pgm)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LRC_03920 (pgm)
Enzymes [BR:lrm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LRC_03920 (pgm)
Exosome [BR:lrm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LRC_03920 (pgm)
  Exosomal proteins of melanoma cells
   LRC_03920 (pgm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
419317..419988
Genome map
AA seq 223 aa AA seqDB search
MVKLVLIRHGQSIANKEDVYTGWSDSPLTRKGISQARHAGKLLFHEKINFSDVHTSVLVR
AIKTANIVLDEIGQSYLPIHKTWRLNERHYGALRGLNKKRTREIYGEEQVALWRRSFYTV
PPLLEKIDHDRRYDCFPDVVVPRGESLKMAYDRIVPYWTDGIAPKLLNGENQLVVAHGST
LRAMIKFIEHISDQGIDGVEVANGTPIIYELDHRLKIVEKKIL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagttggttttaatcagacacgggcaaagcattgccaataaagaagacgtttat
acgggatggtccgactctccgctgacaagaaaaggcatcagtcaagcgcgacatgcgggc
aagttgctgtttcatgaaaaaatcaacttttcggacgtgcacacttccgttttggtgcgc
gcaatcaagaccgcaaacatcgttttggatgaaatcggacaaagctatttgccgattcat
aaaacgtggcgcttgaacgagcgacattacggggcattgcgcggcttaaacaaaaagaga
acgcgcgaaatatacggtgaagaacaggttgcgttatggcgtcgttcattttatacggtg
ccgccgctattggaaaaaattgatcacgacaggcgatacgattgttttcctgatgtcgtc
gtgccgcgcggcgaaagcttgaagatggcttatgacagaatcgtgccttactggacggat
ggaattgcaccgaaattgcttaacggagaaaaccagcttgtcgtggctcacgggagcact
ctgcgcgcgatgatcaagttcattgagcacatcagcgatcagggaatagatggcgtcgag
gttgcaaacggaacaccgataatttatgaactcgaccatcgattgaaaatcgtcgaaaag
aaaattttatag

DBGET integrated database retrieval system