KEGG   Lactobacillus ruminis: LRC_03990Help
Entry
LRC_03990         CDS       T01626                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lrm  Lactobacillus ruminis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lrm00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
425877..427367
Genome map
AA seq 496 aa AA seqDB search
MAKDKIRVRYAPSPTGHLHIGNARTALFNYLFARHNKGTFVLRIEDTDTKRNIADGERSQ
MENLHWLGIDWDEGPDKPGEYGPYRQSERKGIYQPLIQELLDKDLAYESFMTEDELNEQR
EAQKARGEAPRYEYEYEGMTKEEIKAKQDEARAKGLKPVVRIRVPKNVVYEWDDIVKGHV
SFNSDTIGGDFVIQKRDGMPTYNFAVVVDDHMMKITHVLRGDDHVANTPKQLAVYQAFGW
EAPVFGHMSLIINTETGKKLSKRDESVLQFIEQYRSLGYLPEAMFNFITLLGWSPVGESE
IFSQKDFIKMFDPKRLSRSPAAFDGKKLEWVNNQYVKAADNDELSDSAIKQLIKAGKIPE
NPDFKTIAWARHLVDLYKRQMSYTAQLADMAEIFFTEPQKLDEDCMNELSDESAAVVLNE
FSKRIKELPLFDAVEIQKTIRGIQKDTGVKGRKLYMPIRIATTREMHGPELAPSIELLGK
KRVLEHLNKTLEEMGK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaagataagattcgtgtgcgttatgcaccaagtccgacgggacacttgcatatc
ggcaacgcacgaacagcgttattcaactacttatttgcaagacataataaagggactttt
gtactccgcatcgaagacacggatacgaaacgcaatattgcagacggtgaacgcagccag
atggaaaaccttcattggctgggcatcgactgggatgaaggtccggacaagccgggcgaa
tacggcccgtatcgtcaatctgaacgcaagggcatctatcagcctttgattcaggaactt
ttggacaaagaccttgcctatgaatcattcatgaccgaagatgagttgaacgaacagcgc
gaagcacaaaaggcgcgcggtgaggctcctcgctacgaatatgaatatgaaggcatgaca
aaagaagaaatcaaggccaagcaagacgaggcacgtgccaagggcttgaagccggttgtc
agaatccgcgttccgaagaacgtcgtttacgaatgggacgatattgtcaaaggacacgtc
agtttcaattctgatacgatcggcggcgactttgtcattcaaaagcgtgacggaatgcca
acatataattttgccgttgtcgtcgatgaccacatgatgaaaatcacgcacgttttgcgc
ggtgatgatcatgttgccaacacgccgaagcaattggcggtttaccaggcatttggctgg
gaagcccctgtatttggccatatgtcgcttatcatcaatacggaaacaggcaagaaactt
tcaaaacgtgatgaatccgtgcttcagtttattgaacagtatcgttcgcttggatatctg
cctgaagcgatgttcaacttcattactcttcttggctggtcaccggttggcgaatcagaa
atcttcagtcaaaaagatttcatcaagatgtttgatccaaagcgtttgagccgctcaccg
gctgcttttgacggcaaaaagcttgaatgggtcaacaaccagtacgtcaaagctgcagat
aacgatgaactttccgattctgcaatcaagcaattgatcaaagcaggcaagattcctgaa
aatcccgattttaagacgattgcatgggcacgtcatttggttgatctttataagcgtcaa
atgtcttatacggctcaattggccgacatggctgagattttcttcacggaaccgcaaaag
cttgatgaagattgcatgaacgagctttcagatgaatcggctgcagtcgttttgaacgaa
ttctccaagcgcatcaaggaattaccgctttttgacgccgttgagattcaaaagacgatt
cgcggcattcaaaaggataccggagtcaaaggccgcaagctttacatgccgattcgcatt
gcaacgactcgtgaaatgcacggtccggaacttgctccttcaatcgaattgctgggcaaa
aagcgcgtgcttgaacatttaaacaaaacgttggaagaaatgggcaaataa

DBGET integrated database retrieval system