KEGG   Lactobacillus ruminis: LRC_04130Help
Entry
LRC_04130         CDS       T01626                                 

Definition
hypothetical protein
Orthology
K14205  
phosphatidylglycerol lysyltransferase [EC:2.3.2.3]
Organism
lrm  Lactobacillus ruminis
Brite
Enzymes [BR:lrm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.3  lysyltransferase
     LRC_04130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
437619..440192
Genome map
AA seq 857 aa AA seqDB search
MIERFKNFVEKRLKFIKLLFVFSVLIFVVYEIGRIFKQIDWGKVQEGLENQSMLTIAVMF
FVGLIAVLPMIAYDFTVVKFLPGKYSVPYIFKSGWIVNTTTNVAGFGGVIGATLRANFYK
KNASAKQIVYALSKIALFVLAGLSIYCWISLALIYGRGMGKLFGSYWIWLVGGGVYFPVL
FIATKFKQTEFFADLTLKRELALIISSFFEWTFAGGFFLFIGLMMGIKTDFLPILAMYIT
GSVLGIVSMVPGGLGSFDVFMMYGMATLGVSNETAVVWIMFFRLFYYIIPFVIGVILFVH
ETGSNINEKLNGIPKMAVQKVAHFVLTIFLYASGILMLLEAAVPRFANSNELLRKLYSYS
FLFISQVSDIIFAFMLLGLARGISAKGKRAYWPTLIVLAIGVINTLLNRYSLSLAIFLGF
VMILVFLSKNELYRKQMQYSIGKMVADIAIFAGTFLLYTLVGILNTPSFSNRHHVPEYLL
FPAQKDWLAGFIGLMIAALILLLMLTYLSKGLTPFVPQVFDERRIKQIISRFGCGNAGHL
VYLRDKSLYFFKSEGKDQVFFMYRRKQEKLFCIGEPIGNPKYFKEALEDFLKTADLYGFE
PVFYDIDQDFTLLLHEYGYDFLQIGEKGLVDLEKFNLHGEKHHNQRALINRFANDGYVLD
FLKPPYSEELLSEMRKVSDEWLSNRNEKGFSVGFFDEYYLEQGSLMTLRDSSGKLKAFSS
IMPRKHGVVSSDLMRYVKDAPAQTMARLSLFLFENAKEAGYAYVDLGMAPTRDCADLNRE
FITEKIARYIYEYGYHFYSFQGLKAYKNKYVDIWKKSFIAYRKRSQIAFTMFQLMSVINS
KAIKHDYKGLVKPRIFN
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
ttgattgagcgtttcaaaaattttgttgaaaagcgcttgaaatttatcaagctgttgttt
gttttttctgttctgatatttgtcgtttacgaaatcgggcgaatttttaaacagattgat
tggggaaaagttcaagaaggactcgaaaatcagtcaatgctcacgattgcggtgatgttt
tttgtcggcttgattgccgttcttccgatgattgcctatgattttacggtcgtgaaattt
cttcctggaaaatacagtgtgccgtatatcttcaaaagcggctggatcgtcaatacgacg
accaacgttgccggattcggcggcgtcatcggggcaacgttgcgcgccaatttttacaag
aaaaacgcaagcgccaagcagattgtctacgcgctttcgaaaattgcgctgtttgttttg
gcaggactttccatatattgttggatttctcttgcattgatttatggtcgcggcatggga
aaactgttcggcagctactggatctggcttgtcggcggaggagtgtattttcccgtactg
ttcatcgcgacaaaattcaaacagaccgaattttttgccgacttgacgttgaaacgcgaa
ctggccctgattatcagctcttttttcgagtggacgtttgccggcggatttttcttgttt
atcggcttgatgatgggaatcaaaacggattttttgccgattcttgcaatgtatattacc
ggttcggttttgggaatcgtgtcaatggttcccggcggcttgggctcgtttgacgttttt
atgatgtacggcatggcaacgcttggcgtttcaaacgaaacggccgttgtctggatcatg
tttttccggttgttctactacataattccttttgtcatcggggttattctttttgttcat
gaaacaggttcaaacattaacgaaaaattgaacggaattccaaagatggcagttcaaaaa
gtcgcgcatttcgtcttgactatttttttgtatgcttcaggaattttaatgctgcttgaa
gctgccgttccgcgttttgcaaattccaatgagctgttgagaaagctgtattcgtacagt
ttcctgtttatcagtcaggtttcggacattatctttgcctttatgctgctgggacttgcc
aggggaatttcggccaagggcaaacgcgcatactggccgacgctgatcgtgcttgcaatc
ggtgtcatcaatacccttttgaatcgttactcgcttagtctggcgatttttttgggattc
gtaatgattttggttttcctgtcaaaaaacgagctttatcgcaagcagatgcaatattcc
atcggtaagatggttgcagacatcgcgatttttgcggggactttcttactttacacgctg
gtcggaattttgaatacgccaagcttcagcaatcgccatcatgtgccggaatacttgctg
tttcctgctcaaaaagactggcttgccgggttcatcgggttgatgattgcggcactgatt
cttttgctcatgctgacgtacttatcgaaaggcctgacgccgtttgtgcctcaggtcttt
gatgaacggagaatcaagcagatcatcagtcgctttggttgcggaaatgcagggcacctg
gtctacttgcgcgacaaatcgctttatttcttcaaatcagaaggaaaagatcaggtcttt
ttcatgtatcgcagaaagcaggaaaaactattttgcattggggagccgatcgggaatccg
aaatatttcaaggaagctttggaagattttttgaagacggcggatctgtacggctttgaa
cctgttttttacgacatagatcaggatttcacgcttttgctgcatgaatacggctatgat
ttcctgcagattggcgaaaagggtctggtcgatcttgagaaattcaatttgcatggtgaa
aagcatcacaatcagcgggctttaatcaaccgcttcgcaaacgacggctatgtgcttgat
tttttgaagccgccatatagcgaagagttattaagcgaaatgcgcaaagtttcggatgag
tggctgagcaatcgaaacgaaaaaggattttccgtaggcttttttgatgaatattacctt
gagcaaggcagtttgatgactttgagggattcttccggcaagctgaaggctttttcaagc
atcatgccgcgcaagcacggggtagtttcaagcgatctgatgcgttatgtcaaagatgct
ccggcacagaccatggcgcgtttatcgttgtttttgtttgaaaatgccaaagaagcgggc
tatgcttacgttgatcttgggatggcgccgacaagagactgtgccgacttgaatcgtgaa
tttattacggaaaagattgcgcgctatatctatgaatacggctaccatttctacagtttc
caaggccttaaggcttataagaacaaatacgttgacatatggaagaagagctttattgcc
taccgcaagcgttcgcagattgcatttacgatgtttcagctgatgagcgtcatcaactcg
aaggccatcaaacatgattacaagggtttggtcaagccgagaatctttaattaa

DBGET integrated database retrieval system