KEGG   Lactobacillus ruminis: LRC_04820Help
Entry
LRC_04820         CDS       T01626                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lrm  Lactobacillus ruminis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lrm00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lrm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
521748..523028
Genome map
AA seq 426 aa AA seqDB search
MEKMIVKGQQKLSGEVTIGGAKNSTVALIPAAILADTPVKFDSVPDILDVHNLMLILKAM
NVDSTYRRGELLVDPTKIKSVPLPGGAIRSLRASYYFMGALLGKFGEAIVGFPGGDNIGP
RPIDQHIKGFKALGAHVEEKENTVHITTGPEGLHGARIFFDLVSVGATINVLLAAVKAKG
LTIMENVAREPEIVDLATFLNNMGAHIRGAGTNEIRVQGVDSLRSKNVHTIIPDRIEAGT
YLSFAAANGNGVLVKNVITEHLDPFLSKLEEMGVRMEIDEDEIYVPGGDVLSPVNIKTAP
FPGFATDLQQPITPLLMKARGSSTIIDTLYPERTKHIPEMQRMGAKISSKDGIITVGHSI
DLSGTVVEAGEIRAGVSLVGLALMAKGTTVINKADNILRGYDRIVEKFRGLSVDLEVINE
SESLNH
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatgattgttaagggacaacagaagctgtctggcgaagttacaatcgggggc
gccaaaaacagtactgttgcattgattcctgcggccattttggcagatacgcctgttaaa
tttgattcggttccggatattttggacgttcataatctgatgctgattttaaaggcgatg
aatgtcgattcgacttacagacgaggggaacttttggttgatccgacaaaaatcaagagt
gttccgcttccaggcggcgcaattcgaagtttgcgcgcgtcatattattttatgggggct
ttgcttggaaagttcggcgaagcaatcgttggatttccaggcggcgacaatatcggtccg
cgtccgattgatcagcatatcaaaggtttcaaagcgttgggggcgcatgttgaagaaaaa
gaaaataccgttcacattacgacgggtccagaaggattgcacggagcaagaatctttttt
gacctcgtttctgtcggtgcgacgatcaacgttttgttggccgccgtcaaagccaaggga
ctgacgattatggaaaacgttgctcgtgagccggaaatcgttgatttggcaacttttttg
aataatatgggtgcccatattcgcggagccggtacaaatgagattcgcgttcagggcgtt
gattcgctcagatcaaagaacgtccacacgattattcccgatcgaatcgaagcggggacg
tatttgtcgtttgccgcagccaacggcaacggcgtgctggtcaaaaatgtcatcacggaa
cacctggatccgtttttgtccaaattggaggaaatgggcgttcgaatggaaatcgatgag
gatgagatttatgttccgggcggagacgttttgagtccggtaaatatcaaaacggctccc
ttccctggatttgccacggatctgcagcagccgatcacgccgcttttgatgaaggcaaga
ggaagttcgacgattattgacacgctttatcctgaaagaaccaagcatattcctgagatg
cagcggatgggcgcaaagatttccagcaaagacggaattattacggtcgggcattcgatc
gatctttccgggacagtggttgaagcgggcgaaattcgtgccggcgtgtctctcgtcggc
ttggcactgatggctaagggaacgaccgtcatcaacaaagcggacaatattttgcgcgga
tatgaccggatcgttgaaaaattcagaggcttgtcagttgatcttgaagtaattaatgaa
agcgagagtctcaatcattag

DBGET integrated database retrieval system