KEGG   Lactobacillus ruminis: LRC_06620Help
Entry
LRC_06620         CDS       T01626                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
lrm  Lactobacillus ruminis
Pathway
lrm00340  Histidine metabolism
lrm01100  Metabolic pathways
lrm01110  Biosynthesis of secondary metabolites
lrm01230  Biosynthesis of amino acids
Module
lrm_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    LRC_06620 (hisD)
Enzymes [BR:lrm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     LRC_06620 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEN77956
UniProt: G2SMQ8
Position
713592..714881
Genome map
AA seq 429 aa AA seqDB search
MKIYENKNLNEMKKIVSTYTKQTSDPEIERAVDDILKDVRVSQDDALRKYSEKFDGVKIN
DFRVPKEALNKAYDSIDDKLKNAMELAKKNIVSFHKLEIEKGFIDLGTKGIMRGQKVTPL
ESVGLYVPGGRAAYPSTILMSALPAKIAGVKKVVMVTPPQKDGISTAVLAAAKLAGVDEV
YQIGGAQAIAALAFGTQSIPKVDKIIGPGNIFVAVAKKKVFGTVAIDMVAGPSEIGILAD
DSANARQIAADLLSQAEHDPRARAMLITDSKKLAEGVSKEVEIQLRTLPKEKIARQSIED
RGFIAVMDDKEEMFDLMNEVAPEHLEVNLENPTQYLPLIKNAGSVFLGKYASEPLGDYVA
GPNHVLPTGGTARFSSPLGVYDFVKRTSFVQFSKDALAADVEAITTLAREEGLEAHARAV
ESRFGKEDF
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttacgaaaacaaaaatttaaacgaaatgaaaaaaatcgtttcaacatatacg
aaacagacgagcgatcctgaaatcgaaagggcagtcgatgatattttgaaagacgttcga
gtcagtcaggacgatgcgttaagaaaatacagcgaaaaattcgacggggtgaaaataaac
gatttcagggttccaaaagaagcattgaataaagcatatgattcgattgacgataaattg
aaaaacgcaatggagcttgcgaagaagaacattgtcagtttccacaagttggaaatcgaa
aaaggcttcattgatcttggcacgaaaggaatcatgcgcggccaaaaggtgacgccgctt
gaaagcgtcggcttatacgttcccggaggtcgagcagcgtacccttcgacaattctgatg
tcggctttgccggctaagattgctggtgtcaaaaaagtcgtcatggtgactccgccacaa
aaagacggtatttcaacggccgttttggcagcagccaaactggcaggagtcgacgaagtt
tatcagattggcggtgctcaagcaatcgccgcgctggcatttggaacgcaatcgattccg
aaggtcgataaaatcatcggacccggcaatatttttgttgccgttgccaagaagaaggtc
tttggcacggtggcaattgatatggttgccgggccgtctgaaattggcattttggcagac
gattcggcaaacgccagacagattgcggcagatctgctgtcgcaagcagaacacgatccg
cgtgcgcgtgcaatgctgattacagattcgaaaaagttggcagaaggcgtctcaaaagaa
gtcgagattcaattgcggacgcttccgaaagaaaaaatcgctcgccaatcaatcgaagac
aggggctttatcgcagtcatggacgataaagaggaaatgtttgatctgatgaacgaggtt
gctccggaacatttggaagtcaatcttgaaaatccgacccagtatcttcctttgataaaa
aatgcagggtccgtcttcttgggcaaatacgcttcagagcctttgggcgattacgtagcc
ggaccaaaccacgttttgccgaccggcgggactgcacgcttttcttctccgctcggcgtt
tatgatttcgtcaagcgaacttcattcgtccaattttcaaaagatgctttggcagccgat
gttgaggcgattacgacgctggccagggaagaaggacttgaagcgcatgcgagagctgtt
gaaagccgcttcgggaaggaggatttttga

DBGET integrated database retrieval system