KEGG   Lactobacillus ruminis: LRC_06790Help
Entry
LRC_06790         CDS       T01626                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lrm  Lactobacillus ruminis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:lrm00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lrm00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:lrm00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lrm00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
729360..730244
Genome map
AA seq 294 aa AA seqDB search
MKNQKKVRKAVIPAAGLGTRFLPATKALAKEMLPIIDKPTIQYIVEEAKKSGIEDILVVT
GKGKRPIEDHFDSVPELEQNLKEKGKTELLRLVQQTTDINLYFIRQSHPRGLGDAVLMAK
DFVGDEPFVVMLGDDIMEDKVPLTKQLMDRYEETHASTLAVMKVPHEEVSKYGVIDPTSE
TRPGLYDVKRFVEKPPVEKAPSNLAIIGRYLLTPEIFDMLETQKPGAGNEIQLTDAIDRL
NKIQRVFAHEFKGERYDVGYKFGYLKTSIEFGLRHPEVKDDLAKYIKDLAKTLK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccaaaagaaagtaagaaaggctgttattcctgcagcagggttgggaactcgt
tttctcccggccacaaaagctttggctaaggaaatgctgcctatcattgataagccgacg
attcaatatattgttgaagaagctaagaaatcaggaattgaagatattttagtcgttacc
ggcaagggcaagcgtccaatcgaagatcacttcgattccgttcctgaactggaacaaaac
cttaaggaaaagggcaagacggaacttttgcgacttgttcagcaaacgacggacattaac
ttgtactttatccgtcaatctcatccgcgcggattgggcgatgcggttttgatggctaaa
gatttcgttggggatgaaccgtttgttgtcatgcttggtgatgatatcatggaagataag
gttcctttgaccaagcagttgatggatcgctatgaagaaacgcatgcttcaacgcttgca
gtcatgaaggttccgcatgaagaagtttccaagtacggtgttattgatccaacgtcagaa
actcgtccgggtctgtatgacgttaagcgtttcgttgaaaagccgcctgttgaaaaggct
ccgtctaatcttgcaatcatcggtcgatatttgttgacgcctgaaatttttgacatgctt
gaaacgcaaaagccgggcgcaggcaatgagattcagttgacggatgcaattgatcgtctt
aataagattcagcgtgtttttgcacatgaattcaaaggcgaacgttatgatgtcggctac
aagtttggctacttgaagacatcaatcgagtttggactgcgtcatccggaagttaaagat
gatcttgcaaagtatataaaagatcttgcaaagacgcttaaataa

DBGET integrated database retrieval system