KEGG   Lactobacillus ruminis: LRC_07950Help
Entry
LRC_07950         CDS       T01626                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lrm  Lactobacillus ruminis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LRC_07950
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LRC_07950
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LRC_07950
Enzymes [BR:lrm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LRC_07950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
849081..850274
Genome map
AA seq 397 aa AA seqDB search
MMTDSKGRFGTHGGQYISETLMNAVDELEKAYNYYKEDEGFKRELDDLLKKYAGRPSLLY
YAKNMTKDLGGAKVYLKREDLNHTGAHKINNVLGQCLLAKKMGKKRVIAETGAGQHGVAT
ATVAALMGMECEIFMGEVDCKRQALNVYRMKLLGAKVHSVSTGTGTLKDAVSETMREWTR
RIDDTHYVLGSAMGPHPFPTIVRDFQAVISKEAREQILAEEGRLPDAVIACVGGGSNAIG
SFYNFINDKNVELIGCEAAGKGADTFETAATIATGRLGIFHGMKSYFCQDKYGQIAPVYS
ISAGLDYPGVGPEHAFLHDEKRAKYVPITDDEAVDAFEYLSRTEGIIPAIESAHAVAYAK
KIVPKMSKDQIVIVTLSGRGDKDVAAIARYKGENLYD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgatgacggattctaaagggagatttggaacacacggcggtcagtatatttcagaaacg
cttatgaacgccgttgatgaacttgagaaggcttataattactacaaagaagatgaagga
ttcaagcgcgaattagatgatttgctgaaaaaatacgcgggtcgaccgtctttgctttat
tatgccaaaaatatgacaaaagatctcggaggcgccaaagtctatcttaaacgcgaggac
ctcaatcatactggtgcccacaaaataaacaatgttcttggacaatgcctgttggcgaaa
aagatgggcaaaaaacgagtcattgccgaaaccggtgccggtcagcacggcgttgccaca
gcaacggttgctgcattgatgggaatggaatgcgagattttcatgggtgaagtcgattgc
aaaagacaggcattaaacgtttatcgcatgaagcttctgggagcaaaagttcattccgtt
tcaacgggaaccggaacactgaaagatgccgtttctgaaacgatgcgcgaatggaccaga
agaatcgacgacacgcattacgttctcggatctgccatggggccgcatccttttccaaca
atcgtgcgtgattttcaggccgtcatttcaaaagaagcaagagaacaaattttggcagaa
gaagggcgtttgccggatgcggtgattgcctgcgttggcggaggatcaaatgcaatcgga
agtttttataactttatcaatgacaaaaacgttgaactgatcggatgcgaagcggcagga
aaaggagcagatacttttgaaactgcagcaacgattgcgacggggcgcttgggcattttt
cacgggatgaagtcttatttttgtcaggacaaatatggacaaattgcaccggtctattct
atttcagccggattggattatcctggcgttggtccggagcacgcatttttacacgatgaa
aagcgcgcaaaatacgttccgatcacggatgatgaagcagtagacgcatttgagtacttg
tcaagaactgaaggaatcattccggcaatcgaaagtgctcatgctgttgcttatgccaaa
aagatcgttccgaaaatgagcaaggatcaaatcgtaatcgtcacattgtcaggaagaggc
gacaaagatgttgcagcgattgcaagatacaagggggaaaatctgtatgattga

DBGET integrated database retrieval system