KEGG   Lactobacillus ruminis: LRC_07960Help
Entry
LRC_07960         CDS       T01626                                 

Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lrm  Lactobacillus ruminis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LRC_07960
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LRC_07960
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LRC_07960
Enzymes [BR:lrm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LRC_07960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
850267..851046
Genome map
AA seq 259 aa AA seqDB search
MIDRIKEAFENGKAFIPFITSGDPSLETTEQLVYAMDDAGADIIELGVPFSDPTAEGPVI
QAANLRALSAGTTTDKIFSMIAKIRQKTQIPLILMTYANVVYSYDTELFLKKAASVGVDG
LILADVPYEEKEEFSDVCDEYGICLISMVAPTSKERIKMIAKDAKGFVYCVSSLGVTGTR
KEIKTDVSSMVKLVKEANDIPCAIGFGISMPETAHEMALQSDGAIVGSAIVKICEKYGAE
SVPYVAEYVKQMKEAISKL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgattgacagaattaaagaagcatttgagaacggcaaggcattcattcctttcataaca
agcggtgatccgagtcttgaaacaacggagcagcttgtttatgcgatggatgatgctggg
gcagatatcattgaactgggcgtccctttttctgatccaacggctgaaggtcctgtcatt
caggcagcaaatttacgtgcgctttcagcgggtacgacaacggacaagattttttcaatg
attgcaaaaatccggcaaaagacccagattccgctgattttgatgacttatgcaaatgtt
gtctattcctatgatacggaactttttttgaaaaaggctgcaagcgtcggagttgacgga
ttaatcctggcagacgttccttatgaagaaaaagaagagttttccgatgtgtgtgacgaa
tacggaatatgtttgatttcaatggttgcaccgacttcaaaagaacgaatcaagatgatt
gcaaaggatgccaaaggttttgtttattgcgtttcatcgcttggcgtcaccggaaccaga
aaagagatcaaaactgatgtttcaagcatggtcaaacttgtcaaggaagcaaatgatatt
ccgtgtgccatcggttttggaatcagcatgcctgaaactgcccacgaaatggctttgcaa
agcgatggcgcgattgttggctcggcaatcgttaaaatttgtgaaaagtatggtgctgag
tcagttccgtatgttgcagaatatgttaagcaaatgaaagaggctatttcaaagttgtaa

DBGET integrated database retrieval system