KEGG   Lactobacillus ruminis: LRC_12200Help
Entry
LRC_12200         CDS       T01626                                 

Gene name
rsmB
Definition
16S rRNA m(5)C 967 methyltransferase
Orthology
K03500  
16S rRNA (cytosine967-C5)-methyltransferase [EC:2.1.1.176]
Organism
lrm  Lactobacillus ruminis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1269480..1270823)
Genome map
AA seq 447 aa AA seqDB search
MKKLDRNPRFLAVKLLERIEKNGSYSNLALNQTIKKSQLDERDVGLLTNIVYGVIQRKLT
LEFYLDGFIKNGRKVEPWVYELLKTALYQQLYLDKIPKRAIFNETIEIAKVNGHEGIRRF
VTGILHEIERKGLPDPSNVKDSAEKISIESSTPKWLVEKLTEELGFEKTISLLKSINEPP
AQSIRVNLAKNTVHQAVSALEKEGFKVSKSLVSPLGLRVSGGFIPHSDAYKRGLVTVQDE
SAMLAVDSMDVKSTDVVLDGCAAPGGKTMQIAAVLDSGRVYALDIHAHKVGLIEKNAELC
GVTNYVTAKKTDARKAKEEFDEESFDKVLIDAPCSGLGLMRRKPEVKYDKHFKDSLSLHD
VQVGILDQVAELVKPGGRLTYSTCTILNEENQATVDAFLKRHPEFYQIKTETSFKIKDER
KTLGLTIYPDDFGSDGFFIATLMKKEE
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacttgatagaaacccgcgcttcttggcggtcaaactgttggagcgaatcgaa
aaaaacggctcatattccaacctggcattgaatcagacaataaaaaaaagccagcttgat
gaaagagacgtcggtcttttgacaaacatcgtctatggagtcattcaacgaaagctcacc
ttggaattttatcttgacggtttcataaagaacgggcgcaaggtggagccgtgggtttac
gaacttttgaaaacggctctctatcagcagctgtatcttgacaagatcccgaaacgtgcc
attttcaacgaaacgattgaaattgcaaaggtcaacggtcacgaaggaatcagacgattc
gtgaccggaattttgcacgaaatcgagcgcaaaggtcttcccgatccaagtaacgtcaaa
gattctgcggaaaaaatcagtattgaatcaagcacgccaaaatggctcgttgaaaaactg
actgaagaacttggttttgaaaaaaccatcagtctcttaaaatcgatcaatgagccaccg
gcccaaagcattcgggtcaatcttgcgaaaaatacggttcatcaagccgtctcagcattg
gaaaaagagggtttcaaggtttcaaaaagtcttgtttcaccgcttggactgcgcgtaagc
ggtggttttattcctcacagcgatgcttataaaagaggtttggtgactgttcaggacgaa
agcgccatgcttgcagtggattcaatggacgttaagtcaacggacgttgtcttggatggt
tgtgctgccccaggcggaaaaacgatgcagattgcagccgttctcgacagcggaagggta
tatgctcttgacatccacgcccataaggtcggattgattgagaaaaatgccgaactttgc
ggcgtaaccaattatgtgacggctaaaaaaacggatgccagaaaagcaaaagaggaattt
gatgaagaaagttttgacaaagttttgattgatgcgccatgttcaggactcggattgatg
agaagaaagcctgaggtaaaatatgacaagcattttaaagactcgctttctttgcacgac
gttcaggtcggaattctcgatcaggttgcagaactagtcaaaccgggagggagactgaca
tacagtacctgtacgattttgaatgaagaaaatcaagcaaccgtggatgcttttttgaaa
cggcatcctgaattttatcagatcaagacagaaacaagctttaaaatcaaagatgaaaga
aaaactttagggttgactatatatccggatgatttcggatcggacgggttctttatcgca
acattgatgaaaaaagaggaatga

DBGET integrated database retrieval system