KEGG   Lactobacillus ruminis: LRC_12250Help
Entry
LRC_12250         CDS       T01626                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
lrm  Lactobacillus ruminis
Pathway
lrm00230  Purine metabolism
lrm01100  Metabolic pathways
Module
lrm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LRC_12250 (gmk)
Enzymes [BR:lrm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LRC_12250 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_22 RsgA_GTPase AAA_16 NB-ARC AAA_33
Motif
Other DBs
NCBI-ProteinID: AEN78484
UniProt: G2SPH1
Position
complement(1275708..1276334)
Genome map
AA seq 208 aa AA seqDB search
MAKRGMLIVLSGPSGVGKGTVRKEIFSQDDNNFHYSISMTTRKMRPGEVNGKDYYFVSKE
EFEKEIGSGGMLEYAKYVDNYYGTPLKYVNEMLDAGKDVFLEIEVNGAMQVRKKAPDGLF
IFLTPPDLMELRQRIVNRGTDDLETIDKRMKKAVGEIEMMQNYDYAVVNDEVPKAAEKIK
TIIRAERWRVKRFLPDYKKQLKLEGTEI
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaagaggtatgctgatcgtcttgtccggtccgtcaggcgtcggtaagggcact
gttcgaaaagaaattttttctcaagatgataacaactttcactattcaatttcgatgacg
acgaggaagatgcgtcccggtgaagtgaatggcaaagactattattttgtttcaaaagaa
gagtttgaaaaagaaattgggtccggtggcatgcttgaatatgccaaatatgttgacaac
tactatggaacaccgttaaaatacgttaatgaaatgttggatgctggcaaggacgttttt
ttggaaattgaagtcaacggtgcaatgcaggttcgcaaaaaagctccggacggattgttc
atctttttaacgccgcctgatttgatggaattgcgtcaacggatcgtcaatcgcggaacg
gatgaccttgaaacaatcgacaagcgaatgaaaaaagccgtcggtgaaatcgaaatgatg
caaaattatgattatgcggtcgtaaatgacgaagtaccaaaagcagccgaaaaaatcaag
acgattattcgtgccgaacgttggcgcgtaaagcgtttcttgcctgattacaaaaaacaa
ttaaaactggagggaacggagatatga

DBGET integrated database retrieval system