KEGG   Lactobacillus ruminis: LRC_12750Help
Entry
LRC_12750         CDS       T01626                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lrm  Lactobacillus ruminis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LRC_12750
Enzymes [BR:lrm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LRC_12750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1327587..1329974)
Genome map
AA seq 795 aa AA seqDB search
MTEHVKGKAVHIFFEAPNSFYKVLLVKIKEASFQWSEKQITVVGNFADIIEGNEYSFEGR
LTKHARYGMQFQAQNYKSETLATTDGVVSYLSSDIFPGIGKKTAEHIVNVLGKNAINVLL
SDEDKVETLGLSERQKGVLMQGIIENNGTEQTIIELNNLGFSSRITEDIFSRYQEKSLEV
IRKDPYSLATEIRGLGFKRIDQIAQGMGISFDDQKRILGAVLTSLYEECYSNGNTYVNDK
LLLEKSLQLLEGARSEKVDPEKVADTIIEAGHKRKVVIEGKRIYPKSLYNSEQEIAYDLY
RLMNNRDEPIEYDEDEIDRCLEDVQAELSITYGQDQLQAIKDAIKSPVFLLTGGPGTGKT
TILRGITEVYMKLNKIDREDAKGIKLAAPTGRAAQKMANATEMDASTIHHLLGITGGNEI
SANDLDYLNGTLLIIDESSMVDTELMHMLLSCIPDSMQVIFCGDKNQLPSVGPGRVFADM
LESMQIPSKELTHIYRQGDGSSIVKLSRSIVNGEVPSDLLEKTGDRSFIKCSGEQVCSVT
KRIVQIVLKKGQNADDIQVLAPMYMGPAGINQLNRTLAPLMNPTRLNAKSVESGENEFHI
GDRVLQLQNNPEKNIFNGDIGKIIAINEPQKGRGTTMTVRFEGREVELEQADFLNLTLAY
CMSIHKSQGSEFPIVILPMVRQYSRMYARNLLYTALTRAKLKLMLIGEPSAYVNCIRAEA
LNRETMLKQQIVFQFTGKKSKTNPQEKSVQLEAKNDFADVDPSRGSIQKTILNFDNIEKI
DPLIGMEGIDPYQFI
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacacgttaagggaaaagcggtgcatatcttttttgaagcaccaaacagtttt
tacaaggttcttttggtgaaaattaaggaagcaagttttcaatggagcgaaaagcaaata
accgtagtcggaaattttgctgacatcattgaaggaaacgagtattcgttcgaagggcgt
ttaaccaaacatgcacgttatggaatgcagtttcaagcacaaaattataaatctgaaacg
cttgcgacgaccgatggggtggtttcgtatctgtcatcggatattttccccggaatcggc
aaaaaaacagctgaacatatcgtgaacgttttaggaaaaaacgcaatcaacgtgcttctt
tcagacgaggacaaggtcgaaacgcttggcttgagcgaacgccaaaaaggcgttttgatg
cagggaataattgaaaacaacgggactgaacaaacgataatcgagctcaacaatctgggt
ttttcaagtcggattaccgaagacatcttttcgcgttaccaggaaaaatcgttggaagtt
atccggaaagatccatacagtttggcaaccgagattcgcggattgggatttaagcgcatc
gaccagatcgcgcaaggaatggggatttcatttgatgatcaaaagcgaatccttggtgcc
gttttaacttccttgtatgaagaatgctattcaaatggcaacacttatgtcaatgataag
cttttgctcgaaaaatccttgcagcttttggaaggagcacgttctgaaaaggttgatccc
gaaaaagtagctgatacgattatcgaagcaggacataaacgcaaagtagtaatcgaagga
aagagaatatatccgaaatccctttacaattccgaacaagagattgcttatgatctttat
cgcttgatgaataatcgcgatgaaccgattgaatatgacgaagatgaaattgatcgttgt
cttgaagacgtccaggctgaacttagcattacctatggtcaagatcagcttcaggcaatc
aaggatgccattaaatcaccggtttttcttttgactggcggtccaggtacggggaagaca
acgatacttcgagggattaccgaagtttatatgaaactcaataaaattgacagggaagac
gcaaaggggataaagctggctgcgccgacaggacgggctgcgcaaaaaatggccaatgcg
accgagatggatgcttcgacgattcatcatctgctcggaattactggaggcaatgagatt
tccgcaaatgatttagattatttgaatgggacgttgctgattattgacgagtcatcgatg
gtcgatacggaattgatgcatatgcttctttcctgcattcctgacagcatgcaggtcatc
ttttgcggtgataaaaatcagcttccttcggtcggacctggccgagtttttgccgatatg
cttgaaagcatgcagatcccgtcaaaagaattgacgcatatttaccgtcaaggcgacggt
tcttcaatcgttaaactgtcgcgcagtatcgtaaatggcgaagttccatcggatcttttg
gaaaaaaccggtgaccgttcttttataaaatgcagtggcgagcaggtctgcagcgtgacg
aagagaatcgttcagattgtcttgaagaagggacaaaatgcggatgatattcaagttttg
gcaccgatgtacatgggacccgccggaatcaatcaattgaaccgcacgcttgccccgttg
atgaatccaacaagactgaatgctaaaagcgtagagtctggggaaaatgaatttcatatc
ggtgaccgtgttttgcaattgcaaaataatcctgaaaagaatatttttaatggtgatatc
ggcaagatcattgcaatcaatgagccgcaaaaaggacgcgggacaacgatgacggtcaga
tttgaaggacgtgaagtcgagctcgaacaagctgactttttaaatttgactttggcctac
tgcatgtcgattcacaaatctcaaggcagcgaatttccgattgtgattttgccaatggtc
agacaatattcgcggatgtatgcaagaaacttgctttatacggctttgacgcgtgctaag
ctcaaattaatgctgattggcgagccgagtgcttatgtcaattgtattcgtgctgaagct
ttgaatcgtgagacgatgctgaaacaacagattgtttttcaatttaccggaaaaaaatct
aaaacgaatcctcaggaaaagtcggttcagcttgaagccaaaaatgattttgctgatgtc
gatcctagtcgtggcagtattcaaaagacgattttgaattttgacaatattgagaaaata
gatccattaatcggaatggaagggattgatccttatcagttcatataa

DBGET integrated database retrieval system