KEGG   Lactobacillus ruminis: LRC_17510Help
Entry
LRC_17510         CDS       T01626                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
lrm  Lactobacillus ruminis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LRC_17510
   01230 Biosynthesis of amino acids
    LRC_17510
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRC_17510
  Energy metabolism
   00680 Methane metabolism
    LRC_17510
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LRC_17510
Enzymes [BR:lrm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     LRC_17510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1807691..1808284
Genome map
AA seq 197 aa AA seqDB search
MTVIYLVRHGQSQANAKGIWQGAQIDTPLTELGRTQAQNTKKHLEEEGAVFSAVYSSPLL
RAGETAGIIAPNQNITFDSRLKEFDYGMWDGMYWQDILERYSEFFDASENLLPNSWEVTG
GETYDEVKERLQQFFNELTDKHPDENVLVVSHGFTIKLILDLFLNIGNLVNLNEPTNAGI
TKFILKNGARTLVYFNR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgactgtgatttatcttgttcgccatggtcaaagtcaggccaatgccaagggaatctgg
caaggcgcgcaaatcgatacgccgttgaccgaactcggtcgaactcaggctcaaaatacc
aaaaagcaccttgaagaagaaggcgcagtattttctgcagtttattcaagtcccctactt
cgtgccggagaaacggccgggatcattgctccaaatcaaaacattacgtttgattcgcgg
cttaaagaattcgattacggcatgtgggacggcatgtattggcaagacatccttgaaaga
tacagtgaatttttcgatgcttcagaaaatcttcttccgaattcatgggaagttaccggc
ggagaaacctatgacgaagtcaaagaaagattgcagcaattcttcaatgaattgacggat
aaacatcctgatgaaaacgtccttgtcgtcagccacggctttacgatcaaactgattctc
gatctgttcttaaatatcggaaatcttgttaatctcaatgaaccgacaaatgccggcatt
acgaaattcatccttaaaaacggtgctcgcacgctggtttatttcaacagatag

DBGET integrated database retrieval system