KEGG   Lactobacillus ruminis: LRC_17730Help
Entry
LRC_17730         CDS       T01626                                 

Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lrm  Lactobacillus ruminis
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lrm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LRC_17730
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRC_17730
   00620 Pyruvate metabolism
    LRC_17730
   00650 Butanoate metabolism
    LRC_17730
  Lipid metabolism
   00071 Fatty acid degradation
    LRC_17730
  Amino acid metabolism
   00350 Tyrosine metabolism
    LRC_17730
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LRC_17730
   00626 Naphthalene degradation
    LRC_17730
Enzymes [BR:lrm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LRC_17730
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LRC_17730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1829624..1832320)
Genome map
AA seq 898 aa AA seqDB search
MEKEATKPKKKVLTEEEKAARMEAARKYTDTLVDKAAAAESEYAHFTQDQVDKIVAAAAL
AGSEAALMLAHEAVEETNRGVVEDKDTKNRFATENIYNAIKDEKTVGIIAEDKIKGEVQI
AAPLGVLAGIVPTTNPTSTAMFKSLMALKTRNAIVFAFHPQAQKCSVHAAQIVYEAAVEA
GAPKNIIQWVETPSIENTTALIQNRKIASILATGGPGMVNAALKSGNPSMGVGAGNGAVF
VDHTAHLDRAVEDLLLSKRFDNGMICATENSVVIEAPVYKDWMKKMEEKGAYLLPRKDYE
KLADFVFNDKHGVNGPVAGKPARWIAENAGIDLPEGKDVIMFELDSKNIGEKLSSEKLSP
LLSVYKAKDREDGIKIVAALLDYQGAGHNAAIQIGSQADPFLNEFADKTKAARILVNQPD
SIGGIGDIYTDALRPSLTLGTGSWGKNSLSHNLSTSDLLNVKTVAKRRNRPQWVRLPEKI
YYEKNALSYLTDETEHIDRAMIVADPGMVKFGFVDKVYDELEARENPVETSLYGTVHPDP
TLGQTMEIARQMEEFQPDTVIAIGGGSAMDAAKIARYIYEYSLEQEPGFLESYEKVSELF
TRLQQKFVDIRKRIVKFHHGTHTKLFCIPTTSGTGSEVTPYAVITDDNTHVKYPLTDYEM
TPQVAIVDPEFVMTVPKRTVAWSGLDTLSHALESYVSVMASDFTRPWSLQAIKLVFENLE
KSYNYDPKNPTLEGETARENMHYAATLGGMAFANAFLGINHSLAHKTGGEFGLPHGLAIS
IAMQHVIRFNGVSGKVKRTPFPRYEVYRAQKDYADIARALGLKGRTDADLVESLCNKIEE
LMKAVGVKPKLSANGVTKEAFDGALDKLCDLVYNDQCTTANPRQPSLEEIRQLLIDQF
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagaagctacgaagccaaagaaaaaagttttgactgaagaagaaaaagcagca
cgaatggaagctgctcgcaagtataccgataccctcgttgataaagcagcagctgctgaa
agcgaatatgcgcattttacgcaggatcaagttgacaaaatcgttgctgcagccgcgctt
gctggttctgaggcggctttgatgcttgctcatgaagcggttgaggaaacaaatcgcggc
gtcgttgaagataaggataccaagaatcgttttgcaaccgaaaacatctataacgcaatc
aaggatgaaaaaaccgttggaatcatcgctgaagacaaaatcaaaggagaagttcaaatt
gccgcaccgcttggcgttttagccggcatcgtcccaacgacgaatccgacgtcgacggca
atgttcaaatctctgatggcgcttaagacgagaaatgcgattgtctttgctttccatccg
caggctcaaaaatgttccgttcatgctgcacaaatcgtttatgaagcagccgttgaagcc
ggagctccgaaaaacatcattcaatgggtcgagactccgtcaattgaaaatacgacggcg
cttattcaaaacagaaagatcgcatcgattcttgcaacgggcggtcccggaatggtcaat
gccgcactcaagtcgggcaacccgtcaatgggtgttggcgccggcaacggtgcagttttc
gttgatcatacggctcatcttgaccgtgcggttgaagacttgcttttgtccaagcgtttc
gacaacgggatgatttgtgcaaccgaaaattcggtcgtcatcgaagcacctgtttacaag
gattggatgaagaagatggaagaaaagggtgcatacttgctgcctagaaaagactacgag
aagctggctgatttcgtcttcaatgacaagcacggcgtcaacggaccggttgccggcaag
cccgctcgttggattgccgaaaatgccggcattgatttgcctgaaggaaaagacgtcatc
atgtttgaactcgattcgaagaacatcggcgaaaagctctcatcagaaaagctttctccg
ctcctttcggtttataaggcaaaagacagagaagacggcatcaagatcgttgccgcactg
ctcgactaccaaggcgctggtcacaatgcggccattcagattggttctcaggcagatccg
ttcttaaacgaatttgccgacaagacaaaggctgctcgcatcttggtaaatcaaccggat
tcaatcggtggtattggcgacatctatacggatgcgttacgtccatctttgacgcttgga
accggttcatgggggaagaattcattgtcacacaacttatcaacttcagacctgttgaat
gtcaagacggtcgcaaaacgtcgcaatcgtcctcaatgggttcgtttgccagaaaaaatc
tactacgaaaagaatgccttgtcatacttgacggacgaaacggagcacattgatcgcgca
atgatcgttgccgatcctggaatggttaaattcggcttcgttgacaaggtttacgatgag
cttgaagcacgcgaaaatccggtagagacatccctttacggaactgttcatcctgatccg
acgttgggacagacgatggaaatcgcacgccagatggaagaattccaaccggataccgtt
attgccatcggtggcggttccgcaatggatgctgccaagattgcgcgctacatctatgaa
tactctcttgaacaagaacctggcttccttgaaagctacgagaaagtcagcgaactgttc
actcgtctgcagcaaaaattcgttgatatccgcaagagaatcgtcaagttccatcacggc
acgcacacgaaacttttctgcatcccgacaacttcaggtaccggttccgaagttacgccg
tatgcggttattacggatgacaacacgcacgttaagtatccgttgaccgactacgaaatg
acgcctcaggttgcaatcgtcgaccctgaatttgtcatgacggttccgaagagaacagtt
gcatggtcaggtctcgatacactgtcacatgcgcttgagtcatacgtttccgtaatggct
tcagacttcacgcgcccatggtcgcttcaggcaatcaagctcgtatttgaaaaccttgaa
aaatcctacaattatgaccctaagaatcctacgcttgaaggcgaaactgctcgcgaaaac
atgcactatgcggctactcttggcggcatggccttcgcaaatgctttccttggcatcaat
cactcgcttgctcacaagactggcggcgaattcggacttcctcacggtcttgcgatttcg
attgcgatgcagcacgtgattcgtttcaacggtgtatctggcaaagtcaagagaacaccg
ttcccacgctacgaagtttatcgtgctcaaaaggattatgcagacattgcgcgtgcgctt
ggattgaagggcagaacagatgctgatttggtcgaatcattgtgcaacaagattgaagaa
ctgatgaaagccgttggcgtaaagcctaagctttcggcaaacggggttactaaagaagcc
tttgacggcgctttggacaaattgtgcgatttggtttacaacgatcaatgcacgacggca
aaccctcgccaaccaagcttggaagagattcgccagttgttgattgatcaattctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system