KEGG   Lactobacillus rhamnosus LOCK900: LOCK900_0053Help
Entry
LOCK900_0053      CDS       T02730                                 

Definition
Hypothetical protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
lro  Lactobacillus rhamnosus LOCK900
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lro00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    LOCK900_0053
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    LOCK900_0053
Enzymes [BR:lro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     LOCK900_0053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(54994..56571)
Genome map
AA seq 525 aa AA seqDB search
MTTTEKGLYPTEFWTVTAGDLAQKRDHLATPKPETTPGDAAKIVIDPADRHQEWIGAGAA
ITDAAASLIWKQSKEQRSALLHEMFDPEEGHFSTIRIPLGSCEPASQPYYTYDDVPFGEH
DASLSKFSVGEGEPGAPDATKDLKYLIPVVQEILAINPAVKIMASPWSAPAWMKSTGELK
MGGHLRFGEYTNNGYAIKDTFEGVYAQYFVRYLEEYRKYGIPIYAITIQNEPSNAAAWPA
MIWKIPELAHFGYKFLRPALDKTFPDTKIYFWDGSLNVLDVIDKPLSELVTPDEAAAFDG
FAFHTYDGPYTNLFKGSRLNPNWKLAMTERRCMIEETPEDASHIMFGLIGNWLVRQGLNM
IDLWNIALDERGLPNQVGSTGRRGVVTIDHTTGKVQRNLEYYMLRNFNQDVVPGSIVIGS
TNYTQDGYTGGLGSVAFLAPDGAIAAHLYNPSGKPLDAAVTINNDGPVTWQHVTVPAWGT
VTLHKAFGPVNESAPRQDEDFKLNPYPANLMDDWAPGKGVNANKK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaactgaaaaaggcttatacccgacggaattttggacggtaacggctggcgat
ctggcacaaaagcgtgaccatctggcaactccaaaaccagaaacgacacccggcgatgca
gccaagatcgtgattgatcctgctgaccggcatcaggaatggatcggcgcaggtgccgcc
atcaccgatgcagcagcatcacttatctggaagcagagcaaggaacaacgcagtgccttg
ctacatgaaatgtttgacccagaagaaggtcatttctcgaccatccgtattccattagga
tcctgcgaaccagccagtcaaccttattacacttatgatgatgtgccatttggcgagcat
gatgcatccttatctaagttttctgttggtgaaggtgaacccggagcgcctgatgcaacc
aaagatcttaaatatctgattccggttgttcaggaaattctggcgattaacccagccgtt
aagattatggcttcaccatggtctgctcccgcttggatgaagagtaccggcgaactaaaa
atgggcggccacttacgctttggcgaatataccaacaatggttatgcgattaaggacacg
ttcgaaggcgtttacgcgcaatactttgttcgttaccttgaagaatatcgcaagtatggc
attccgatttacgccatcacgatccaaaatgaaccttccaatgcagctgcatggccagcc
atgatctggaagattccggaactggcacactttggctacaagttccttcgcccggctttg
gataagaccttccctgataccaagatttacttctgggatggcagtttaaacgtccttgat
gtcatcgacaagccacttagcgaattggtgacccctgatgaagcggctgcatttgatggt
tttgccttccatacctacgatggtccttacaccaacttgtttaaaggcagtcgcctgaat
ccaaactggaaacttgccatgaccgaacgccgctgcatgatcgaagaaacaccagaagat
gcctctcatattatgtttggcttgatcggtaattggctcgtgcgtcaaggcttgaacatg
attgatctctggaacattgccttggacgaacggggcttgccaaaccaggtagggtcaact
ggccgtcgcggggttgtcaccattgatcacacaaccggtaaagttcaacgtaacttggaa
tactacatgctgcgtaacttcaaccaagatgttgttccgggatctattgtgattggctcc
accaactacacgcaagatggctacaccggcggcttaggctccgttgcctttcttgctccc
gatggcgccattgctgctcacctctacaacccatccggcaagccgttggacgccgccgtt
accatcaacaatgacggcccggttacttggcaacatgttaccgttccggcatggggaacc
gtgacgcttcataaggcatttggtcccgttaatgaaagtgcgccgcgtcaggatgaagac
ttcaagctgaatccttacccggcaaatctgatggacgactgggcaccgggcaaaggtgtg
aatgctaacaagaaataa

DBGET integrated database retrieval system