KEGG   Lactobacillus rhamnosus LOCK900: LOCK900_0359Help
Entry
LOCK900_0359      CDS       T02730                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lro  Lactobacillus rhamnosus LOCK900
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lro00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LOCK900_0359
Enzymes [BR:lro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LOCK900_0359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
359523..360464
Genome map
AA seq 313 aa AA seqDB search
MPNHVVVIGSINVDAILHIQRLPQPGETIQMDAFSKAAGGKGANQAVAAARSGAKTSFIG
RVGDDANAAFMRGELVKNQIDTQYVATTADTETGQAYILLQASGQNSIIIQHGANFELTP
ADVQRATGLIQSADFVVAELETPVAATAEAFKIAKAAGKVTILNPAPAQKELPEALLKNV
DLIAPNETESELITGIPVTDEASMRQSAAYYHQLGIRGVVITLGSKGSFISLDGQATLVP
AFKVKAVDTTAAGDTFIGALVSNLQPDLGNIVDAATYASMASSFTVQKLGAFPSIPMGDE
VRAGLAKVKMDPA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcctaatcatgttgtcgttatcggcagtatcaatgtggatgctattttacacattcaa
cgactgccacagccgggagaaacaattcaaatggatgctttttctaaagctgccggtggt
aagggggccaatcaagcggttgcggcggcgcgatctggcgctaagaccagtttcatcggg
cgcgtcggggatgatgccaatgctgctttcatgcgtggcgagttggtgaaaaatcaaatt
gatacccaatatgttgcgaccaccgcagacacggaaaccggccaggcgtatattctgctc
caagcatcgggccaaaactcgatcatcattcaacatggcgccaactttgaactgacgcca
gcggatgtgcagcgggcgactggcttgattcaatcggctgactttgtggttgctgaactg
gaaacgccggtagccgctacagccgaagcattcaaaattgccaaagctgcgggtaaggta
accatcttaaaccctgcaccggcgcaaaaagaactgccagaggcgctgttgaaaaatgtt
gatctaatcgcgcccaacgagactgaaagcgaattgattaccggcattccggttaccgat
gaagccagcatgcgccagtccgccgcgtattatcatcaactcggcatccgcggggtggtc
atcacgcttggttcgaaagggtctttcatttcgctggatggtcaggcaaccctcgtcccg
gctttcaaggtcaaagctgtggatactacggcagcaggggatacctttatcggcgcttta
gtcagcaaccttcagcccgatctcggcaatattgtcgatgcggcaacttacgccagcatg
gccagctcgtttactgtccagaagctcggcgcattcccgtcgattccgatgggggatgag
gtgcgtgcggggttggcgaaggttaaaatggatcctgcgtaa

DBGET integrated database retrieval system