KEGG   Lactobacillus rhamnosus LOCK900: LOCK900_0555Help
Entry
LOCK900_0555      CDS       T02730                                 

Definition
NADP-specific glutamate dehydrogenase
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
lro  Lactobacillus rhamnosus LOCK900
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lro00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    LOCK900_0555
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LOCK900_0555
   00330 Arginine and proline metabolism
    LOCK900_0555
Enzymes [BR:lro01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     LOCK900_0555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
554614..555957
Genome map
AA seq 447 aa AA seqDB search
MTSATAYVESVLATLKQRDPHQPEFLEAATTILKTVVPVFEKHPEYIQANILGRLVEPER
AIQFAVPWQDDQGQIQVNRGFRVQFNSAIGPYKGGLRLHPSVNLSIVKFLGFEQIFKNSL
TTLPIGGAKGGADFNPKGKSDAEIMRFCQSFMTELSKYIGPDLDVPAGDIGVGAREIGYL
YGQYKRLKGAQRGVLTGKGLSYGGSLARTEATGYGLIYYTDELLKANGETLAGKRAVISG
AGNVAIYAAQKAKALGVKVLTVSDSNGYVVDENGIDLATVKQIKEVERGRIKTYAERVDG
AKYYEGSVWDAAIKFDLALPCATQNEINGAQAKRFKAAGVIAVAEGANMPSDPDAIAAYQ
HDDILYGPAKAANAGGVAVSALEMSQNSRRLSDSFDTVDGQLHEIMQHIFKASADAAAEY
GVPGDYEAGANIAGFLKVADAMYAQGM
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagcaacagcttatgtcgaatcggttctcgcaacgctcaaacaacgcgatccg
caccagccggagtttttggaagcagcgacaactattttaaaaaccgttgtcccggttttt
gaaaaacatccggagtatatacaagccaacattcttggccgcttggttgaaccggaacgg
gccattcaatttgccgtgccgtggcaggatgaccaaggccaaatccaagtgaaccgcggc
tttcgggtgcaattcaattccgccatcggtccatacaaaggcggcttacggttacatccg
tcagtcaatttaagtatcgtgaaatttttgggctttgaacaaatcttcaagaatagcctg
acgaccttgccaatcggtggggcaaaaggcggggctgattttaatcccaaaggtaaatcg
gatgcggaaatcatgcgtttttgtcaaagcttcatgaccgagctgagcaaatacatcggg
ccggacctggatgtgccagccggggatattggcgttggcgcacgggaaatcggttaccta
tatggtcaatacaagcgacttaaaggagcacagcgcggcgttttaaccggcaaaggtctc
agttatggcggctcgttggcacgcacggaagctaccgggtacggcttgatctattacaca
gatgaattactcaaggctaatggcgaaacgcttgccggtaagcgggcggtcatttccggt
gctggtaatgttgccatttatgccgctcaaaaggcaaaagcactgggggttaaagtgctc
acggtttccgattcaaatggctacgtggtggatgaaaatgggatcgatcttgccaccgtc
aagcaaattaaagaagtagagcgtggtcgaatcaaaacttatgccgagcgggttgacggc
gctaaatattatgaaggttcggtttgggatgcagcgattaagtttgatctggccttgccg
tgtgccacccaaaatgaaattaatggagcgcaggccaagcgctttaaggctgcaggcgtg
atcgccgtggcagaaggcgccaacatgcccagtgatccggatgccattgcggcttatcag
catgacgacattttatacggtccggccaaagcggccaatgctggcggcgtggcagtctcc
gcactcgaaatgagccaaaattcgcggcgtttaagtgatagcttcgacacggttgacgga
cagttgcacgagatcatgcagcatattttcaaagccagtgccgatgctgccgccgagtat
ggggttccaggtgattacgaggccggggccaacatcgccggcttcttgaaagttgccgat
gcgatgtatgcacaaggcatgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system