KEGG   Lactobacillus rhamnosus LOCK900: LOCK900_1133Help
Entry
LOCK900_1133      CDS       T02730                                 

Definition
Thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lro  Lactobacillus rhamnosus LOCK900
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lro00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LOCK900_1133
Enzymes [BR:lro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LOCK900_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1088612..1089205
Genome map
AA seq 197 aa AA seqDB search
MAQLFFRYGAMNSGKSIEILKVAHNYEEQNKRVILMTSAVDDRAGVGMIASRIGLERTAI
PIAHETNLYDVIKTTDPKAACVLIDEAQFLQKHHIFEAARVVDELHIPVMAFGLKNDFRN
ELFEGSKYLLLYADKIEEMKTICWFCAKKAIMNLRIHDGKPVYEGEQVLIGGNESYYPVC
RHHYFHPPLDKIDQDEE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcttttctttcgttatggcgcaatgaactcaggaaaaagtattgaaattctg
aaagttgcccacaattatgaagaacaaaataagcgcgtgattttaatgaccagcgccgtg
gatgatcgcgccggtgttggcatgatcgccagtcgtattggccttgagcggactgcgatt
ccgattgcgcatgaaacgaatctgtatgatgtcattaaaacgactgatccgaaagcggcg
tgtgttttaattgatgaggcgcagtttttgcagaagcatcatatttttgaagctgcgcgg
gtggttgatgagttgcatattccagtcatggcgtttggtttgaagaacgatttccgcaat
gagctgtttgaaggctcaaaatatttgttgttgtatgcggataaaattgaagaaatgaag
acgatttgctggttttgcgcgaaaaaggcgattatgaatttacggattcatgatggcaag
ccggtgtatgaaggcgagcaggttttgattggcggcaatgaatcgtattatccggtttgc
cggcatcattattttcacccgccgttggataagattgatcaggatgaggaatag

DBGET integrated database retrieval system