KEGG   Lactobacillus rhamnosus LOCK900: LOCK900_2662Help
Entry
LOCK900_2662      CDS       T02730                                 

Definition
Class II aldolase/adducin domain protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lro  Lactobacillus rhamnosus LOCK900
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lro00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LOCK900_2662
Enzymes [BR:lro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LOCK900_2662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2626185..2626913)
Genome map
AA seq 242 aa AA seqDB search
MTEQYVFENERKDLAEVAREMFVRKNTNVAGGNISVRITADKDIDYGSIHIKAGKDYLIM
TPTMMSEAWYAKLQPTQILVVDLETGKQIDGVGRLTREINMHEEAYRANDKIRCVYHSHA
EESMFWATAGLDMPNVTEVTEEVGPIRVLPYAPACSKELADTVYNGLKAVGDAAKEHIFL
LNSHGVLITSEDLHHATEILETVEWNAKIAYQQTVFMKLGLLDSYQSCGKASDGMLKEQV
QA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacagtatgtatttgaaaatgagcgtaaggatttggcagaagtagcgcgcgaa
atgtttgtgcgaaagaatacgaatgtcgctggtggcaatatcagcgttcgtattaccgcg
gataaagatattgattatggcagcattcatattaaggccggcaaagattatcttattatg
acgcctaccatgatgtcagaagcttggtatgcgaagttacaaccaactcaaattttggta
gtcgatcttgagactggcaagcagattgatggggtcggccgtttgacccgggaaattaat
atgcatgaagaggcttatcgcgccaatgataagatccgttgcgtttaccattcacatgcc
gaagaatcaatgttttgggcaactgctggccttgatatgccaaatgttaccgaggtcact
gaagaagtcggaccgattcgcgtattaccctatgcaccggcttgctcaaaagaacttgcc
gacactgtctataatgggctcaaagcggtgggcgatgctgcaaaggaacacattttcttg
ttaaatagccacggcgttttgattacgtcggaagatttgcatcatgcaaccgagattttg
gagacggttgagtggaatgcaaaaattgcctatcagcaaacggtcttcatgaagctgggg
ctgctcgatagttatcagtcttgcggtaaagcgagtgatgggatgttgaaagaacaggta
caggcctga

DBGET integrated database retrieval system