KEGG   Lactobacillus reuteri TD1: N134_01820Help
Entry
N134_01820        CDS       T02745                                 

Definition
(RefSeq) gamma-glutamyl kinase (EC:2.7.2.11)
  KO
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lrr  Lactobacillus reuteri TD1
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lrr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    N134_01820
  Amino acid metabolism
   00330 Arginine and proline metabolism
    N134_01820
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    N134_01820
Enzymes [BR:lrr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     N134_01820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(425330..426118)
Genome map
AA seq 262 aa AA seqDB search
MTHKIQKVVVKIGTSSLVLPNGKINLRTIDQLSFVLATLNNQGYQLILVSSGAIGVGLAS
LGLTERPAEIAQQQALASIGQAALMRIYSQRFLDYQTHVAQLLLTRDVLTYPVSRQHTLN
TINTLLQQNVIPIVNENDPVSVDELDHYTTFSDNDELSSQVAVAIDADELIILSDIDALY
DKDPHKFPDAQIIKEVPFLTPEIENVASGSSTRFGTGGMVTKLRAAATMMQAGKQMILCN
GRDPKILFDIFDGHTIGTHFGK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgactcataaaatacaaaaagtggttgttaagattggcacgagtagccttgttcttcct
aatggaaaaatcaatttacgaacaatcgaccaactctcatttgtccttgcgacattaaac
aatcaaggataccaacttattcttgtttcctcaggagcaattggcgttggtcttgcaagt
ttaggattaacagagcgtcccgccgaaatagcacaacagcaagccttagcatctatcggt
caggctgctttaatgcgaatctattcgcaacgatttttagactatcaaacgcacgttgcc
caacttctccttacccgtgatgtgctcacttatcctgtcagtcgccaacatacgcttaat
acaattaatactttactgcagcaaaatgtaattccaatcgttaacgaaaatgaccccgtg
tcagttgatgagcttgatcattacactacttttagtgacaatgatgaactttcttcccag
gtagctgtcgctattgacgctgacgaactaatcattctttcggatatcgatgccctttat
gacaaagatccgcataaatttcctgacgcgcaaataattaaagaagttccattcctaacg
ccggaaatagagaacgtcgcaagcggtagtagcactaggtttggaacaggtggaatggta
actaaattacgggcagctgccacaatgatgcaagcaggtaaacaaatgattttatgcaat
ggtcgtgaccctaaaattctttttgatatttttgatggtcatactattggtactcatttt
ggaaaatag

DBGET integrated database retrieval system