KEGG   Lactobacillus reuteri TD1: N134_02095Help
Entry
N134_02095        CDS       T02745                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lrr  Lactobacillus reuteri TD1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
486614..487390
Genome map
AA seq 258 aa AA seqDB search
MITYAGESFFFPHSGRRGVILLHAYTGNTNDVRMLGRQLNWQGYTVFAPLLSGHGGDPRK
VLENNGPDDWWDDTRMAIFRLRDAGIDQIAIFGLSLGGLLATRALENDPQLLGGGVFASP
ITTWGQSNVPEYFPKIAAKYYRQQKINPLITKEKVAKLTERLPKQLAQIQTMAHQICDQL
DQIHQPFFIAQGGADEMIDPVSGLQLKARLQANGVAVDYHYYPTATHLLTVNTAHRQLFA
DVEKYLQNLFEVSSNDNK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgataacgtatgctggtgagtcttttttctttccccatagtggacgtcgtggagttatt
ttgcttcatgcatatacaggaaatacgaatgatgttcgaatgttaggacgtcaactcaat
tggcaaggatatacagttttcgcaccgcttttgagtgggcatggtggtgatccacgaaag
gtactagaaaacaatggtccagatgattggtgggatgatacccggatggcaatctttcgt
ttacgcgatgctggaattgatcaaattgcaatttttggtttatcgctcggtggtttactt
gccaccagggctcttgagaatgatccgcaattattaggtggtggtgtttttgcatcccca
attaccacctggggacaatcgaatgttccagaatactttcctaaaattgcggcaaagtat
tatcgtcagcaaaaaatcaatccattaattactaaggaaaaggttgctaaattgactgaa
cgactccctaaacaactagcacaaattcaaacaatggcgcatcaaatttgtgaccaatta
gatcagattcatcaacctttctttattgcacagggaggcgcggatgaaatgattgatcca
gtgtctggcctgcaattaaaagcaagattacaagcaaatggggttgcagttgattatcat
tactacccaaccgctactcacttattaacagttaataccgctcatcgtcaactatttgcc
gatgtagaaaaatatttacaaaatttattcgaggtgtcttctaatgacaacaaataa

DBGET integrated database retrieval system