KEGG   Lactobacillus reuteri TD1: N134_07020Help
Entry
N134_07020        CDS       T02745                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
lrr  Lactobacillus reuteri TD1
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrr00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    N134_07020
   00330 Arginine and proline metabolism
    N134_07020
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    N134_07020
Enzymes [BR:lrr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     N134_07020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1442376..1443296
Genome map
AA seq 306 aa AA seqDB search
MNLNDAIQECWSKIDEGQVATYIPALAKVDPYQLGVYLFDVTNDKKVEAGASQVRFAIES
VSKVITLLYAIERLGLSAVEEQVGTRQTGFPFDTILNMEITKETHPLNAFINSGAILISS
LIEEQDGLSPFDQILEFSRKICNDPAITLNEEIYQSELRTGDMNRSLAYYLKAKEVLTND
VTLSLDTYFKQCSMMVTCQSLANLGAILANDGIAPWNNERIISSEAATYTKSVMMTTGLY
NESGTYSVRIGVPTKSGVGGGLVSAAPNHYGIGIFSPALDHAGNSVAGLALLELISKKLK
LDIFRY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttaatgacgcaattcaagaatgttggagcaaaattgacgaaggacaggtagcg
acatatattcccgctttagcaaaagttgatccttatcaacttggcgtttaccttttcgac
gtcacaaatgataaaaaagtagaagcaggcgcatcgcaagttcggtttgctatcgaaagt
gtctcgaaagtaatcaccctcctctacgcaattgaacgtttaggcttgtcagcagttgaa
gagcaagtgggaacacgccaaaccggcttcccgttcgatacaatccttaacatggaaatc
actaaagagacgcaccccctcaatgcttttattaatagtggcgctatcctcatcagttca
ttaatcgaagaacaagatgggctttctccctttgaccaaatccttgaatttagtcgtaaa
atctgcaatgatcccgctatcaccctcaatgaagagatttaccaatcggagttgcgaacc
ggagatatgaatcggtcgttagcctactatctcaaggccaaagaagtcctcactaatgac
gtaacccttagccttgatacctattttaagcagtgttcaatgatggtcacttgccaaagt
ctagctaatctcggtgctatccttgccaatgacgggatcgctccttggaataatgaacga
atcatttcaagcgaagccgctacatatacaaaatcggtcatgatgacgactggcctctac
aatgaatcaggaacttattccgttcgaatcggtgtaccgactaagagcggtgtcggtggc
ggtttagtttctgctgcccccaatcattacgggatcggaattttcagtccggcactcgac
catgctggtaatagtgttgctgggctagcactccttgaactcatcagcaaaaaattaaag
cttgatatttttaggtactag

DBGET integrated database retrieval system