KEGG   Lactobacillus reuteri I5007: LRI_1467Help
Entry
LRI_1467          CDS       T02701                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lrt  Lactobacillus reuteri I5007
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LRI_1467
Enzymes [BR:lrt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LRI_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1501204..1501779)
Genome map
AA seq 191 aa AA seqDB search
MAQLFFKYGAMNSGKSIDILKVAHNYEEQGKPVVLMTSGVDDRSGRGIIASRIGLERKVK
PIMDDTNIYDYVNKMDRKIYCVLIDEAQFLKKEHVLQLIKIVDELNIPVMAFGLKNDFRN
ELFEGSKYLLIYADKIEEMKTICWFCPHKATMNLRIHNGKPVYEGEQVQIGGNESYYPVC
RKHYFHPQLKQ
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaactattctttaaatatggcgcgatgaattctggtaagtcaatcgatattttg
aaggttgctcataactatgaagaacaaggaaagccggttgtcttaatgacgagcggcgtt
gatgatcgttctggtcgagggatcattgctagtcgaattggcttagagcgtaaggtaaaa
ccaattatggatgacaccaatatttacgattacgttaataagatggaccgtaagatatat
tgtgtattgattgacgaagcacagtttttaaagaaagagcatgtcttacaattaatcaaa
attgttgatgagctaaatattccggtaatggcttttggactaaagaatgactttcggaat
gaattatttgaaggttcaaaatatttactgatttatgctgacaaaattgaagagatgaaa
acaatttgttggttctgtcctcacaaagctacgatgaatttacggattcataatggcaag
ccagtatatgagggagaacaagtccagatagggggaaatgaatcatattacccagtatgc
cggaagcactattttcatccccaattaaaacaatag

DBGET integrated database retrieval system