KEGG   Lactobacillus reuteri I5007: LRI_1539Help
Entry
LRI_1539          CDS       T02701                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lrt  Lactobacillus reuteri I5007
Brite
Enzymes [BR:lrt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     LRI_1539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1573112..1573888)
Genome map
AA seq 258 aa AA seqDB search
MITYTGESFFFPHSGRRGVILLHAYTGNTNDVRMLGRQLNWQGYTVFAPLLSGHGGDPRK
VLESNGPGDWWDDTRMAIFRLRDAGIDQIAIFGLSLGGLLATRALENDPQLLGGGVFASP
ITTWGQSNVPEYFPKIAAKYYRQQKINPLITKEKVAKLTEQLPKQLAQIQTMAHQICDQL
DQIHQPFFIAQGGADEMIDPASGLQLKARLQANGVAVDYHYYPTATHLLTVNTAHRQLFA
DVEKYLQNLFEVSSNDNK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgataacgtatactggtgagtcttttttctttccccatagtggacgtcgtggagttatt
ttgcttcatgcatatacaggaaatacgaatgatgttcgaatgttaggacgtcagcttaat
tggcaagggtatacagtcttcgcaccgcttttgagtgggcatggcggtgatccacgaaaa
gtactagaaagcaatggtccaggtgattggtgggatgatacccggatggcaatctttcgt
ttacgcgatgctggaattgatcaaattgcaatttttggtttatcgctcggcggtttactt
gccaccagggctcttgagaatgatccgcaattattaggtggtggtgtttttgcatcccca
attaccacctggggacaatcaaatgttccggaatactttcctaaaattgcggcaaagtat
tatcgtcaacaaaaaattaaccccttaattactaaggaaaaggttgctaaattgactgag
caactccccaaacaactagcacaaattcaaacaatggcgcatcaaatttgtgaccaatta
gatcagattcatcaacctttctttattgcacagggaggcgcggatgaaatgattgatcca
gcgtctggtctgcaattaaaagcaagattacaagcaaatggggttgcagttgattatcat
tactacccaaccgctactcacttattaacagttaataccgctcatcgtcaattatttgcc
gatgtagaaaaatatttacaaaatttattcgaggtgtcttctaatgacaacaaataa

DBGET integrated database retrieval system