KEGG   Lactobacillus reuteri I5007: LRI_1593Help
Entry
LRI_1593          CDS       T02701                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lrt  Lactobacillus reuteri I5007
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lrt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LRI_1593
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LRI_1593
Enzymes [BR:lrt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     LRI_1593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1633978..1634766
Genome map
AA seq 262 aa AA seqDB search
MTHKIQKVVVKIGTSSLVLPNGKINLRTIDQLSFVLATLNNQGYQLILVSSGAIGVGLAS
LGLTERPAEIAQQQALASIGQAALMRIYSQRFLDYQTHVAQLLLTRDVLTYPVSRQHTLN
TINTLLQQNVIPIVNENDPVSVDELDHYTTFSDNDELSSQVAVAIDADELIILSDIDALY
DKDPHKFSDAQIIKEVPFLTPEIENVASGSSTRFGTGGMVTKLRAAATMMQAGKQMILCN
GRDPKILFDIFDGHTIGTHFGK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgactcataaaatacaaaaagtagttgttaagattggtacgagtagccttgttcttcct
aatggaaaaattaatttacgaacaatcgaccaactctcatttgtccttgcgacattaaac
aatcaaggataccaacttattcttgtttcctcaggagcaattggcgttggtcttgcaagt
ttgggattgacagagcgtcccgccgaaatagcacaacagcaagccttagcatctatcggt
caggctgctttaatgcgaatctattcgcaacgatttttagattatcaaacgcacgttgcc
caacttctccttacccgtgatgtgctcacttatcctgtcagtcgccaacatacgcttaat
acaattaatactttactgcagcaaaatgtgattccaatcgttaacgaaaatgaccccgtg
tcagttgatgaacttgatcattacactacttttagtgacaatgatgaactttcttcccag
gtagctgtcgccattgacgctgatgaactaatcattctttcggatatcgatgccctttat
gacaaagatccgcataaattttctgacgcacaaataattaaagaagttccattcctaacg
ccggaaatagagaacgtcgcaagcggtagcagcactaggtttggaacaggcggaatggta
actaaattacgggcagctgccacaatgatgcaagcaggcaaacaaatgattttatgcaat
ggtcgtgaccctaaaattctttttgatatttttgatggtcatactattggtactcatttt
ggaaaatag

DBGET integrated database retrieval system