KEGG   Lactobacillus reuteri I5007: LRI_1617Help
Entry
LRI_1617          CDS       T02701                                 

Definition
aldehyde-alcohol dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
lrt  Lactobacillus reuteri I5007
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lrt00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LRI_1617
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LRI_1617
   00620 Pyruvate metabolism
    LRI_1617
   00650 Butanoate metabolism
    LRI_1617
  Lipid metabolism
   00071 Fatty acid degradation
    LRI_1617
  Amino acid metabolism
   00350 Tyrosine metabolism
    LRI_1617
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LRI_1617
   00626 Naphthalene degradation
    LRI_1617
Enzymes [BR:lrt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LRI_1617
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LRI_1617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1657454..1660090
Genome map
AA seq 878 aa AA seqDB search
MPANNKKQVEKNVLTEEEKKQNAQKLVDDIIAKSEAAFEQLRYYSQEQVDKICQAMALAA
EEHHMDLAIDAAEETGRGVAEDKAIKNIYASEYIWNNIRHDKTVGIIKDNDEDQTITIAD
PLGIIAGIVPVTNPTSTTIFKSIISAKTRNTIIFSFHRQAMKSSIKTAKILQEAAEKAGA
PKNMIQWLPESSRENTTALLQHPKTATILATGGPSLVKAAYSSGNPALGVGPGNGPAYIE
KTANIERSVYDIVLSKTFDNGMICATENSVVVDEEIYDKVKEEFQKWNCYFLKPNEIDKF
TEGFIDPKRHQVRGPIAGRSANAIADMCGIKVPENTKVIIAEYEGVGDKYPLSAEKLSPV
LTMYKATSHENAFDICAQLLHYGGEGHTAAIHTLDDDLATKYGLEMRASRIIVNSPSGIG
GIGNIYNNMTPSLTLGTGSYGGNSISHNVTDWDLLNIKTIAKRRENRQWVKIPPKVYFQR
NSLKELQDIPNINRAFIVTGPGMSKRGYVQRVIDQLRQRQNNTAFLVFDDVEEDPSTNTV
EKGVAMMNDFKPDTIIALGGGSPMDAAKAMWMFYEHPETSWYGVMQKYLDIRKRAYQIKK
PTKSQLIGIPTTSGTGSEVTPFAVITDSETHVKYPLADYALTPNIAIVDSQFVETVPAKT
TAWTGLDVLCHATESYVSVMATDYTRGWSLQTIKGVMENLPKSVQGDKLARRKMHDFSTM
AGMAFGQAFLGINHSLAHKMGGAFGLPHGLLIAIAMPQVIRFNAKRPQKLALWPHYETYH
ATKDYADIARFIGLKGNTDEELAEAYAKKVIELAHECGVKLSLKDNGVTREEFDKAVDDL
ARLAYEDQCTTTNPVEPLVSQLKELLERCYDGTGVEEK
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctaacaacaaaaaacaagttgaaaaaaacgtattaactgaagaagaaaaaaag
caaaatgcgcaaaaattagttgatgatataattgccaaaagtgaagcagcttttgaacaa
ttacgttactactcacaagaacaagttgataaaatttgtcaagccatggccttagctgct
gaagaacaccacatggacttagctattgatgcagctgaagaaactggtcgtggggttgcc
gaagataaagctatcaagaacatctacgcaagtgaatatatttggaacaacatccgtcat
gacaagactgttggtattatcaaggataatgacgaagaccaaacaatcacgattgctgat
cctcttggcatcattgctggaattgttccagttactaaccctacttcaactactattttc
aaatcaattattagtgctaagacgcggaatacaatcatcttttctttccaccgtcaagcc
atgaaatcttccattaaaacagctaagattttacaagaagctgctgaaaaggccggtgca
ccaaaaaacatgattcaatggcttcctgaaagtagccgtgaaaacacaaccgcattgtta
caacaccctaagactgctactattttagcaaccggtggtccttcattggttaaagctgcc
tacagttcaggtaaccctgctcttggtgttggtcctggtaacggtccagcttacattgaa
aaaactgctaatattgaacgttctgtttacgatatcgttctttccaagacttttgataac
ggaatgatctgtgctactgaaaactcagttgttgttgatgaagaaatctacgacaaggta
aaagaagaattccaaaagtggaactgttacttcttgaagccaaatgaaattgataagttt
actgaaggcttcattgatcctaagcgtcaccaagttcgtggaccaattgctggtcgttca
gctaacgccatcgctgatatgtgtggaattaaagttcctgaaaatactaaggtgattatt
gctgaatatgaaggtgttggtgacaagtacccactttctgctgaaaagctttcaccagta
ttaacaatgtacaaggccacttcacatgaaaatgcctttgatatctgtgctcaattattg
cactatggtggtgaaggtcacactgctgctattcacacccttgatgatgatttagcaact
aagtacggtcttgaaatgcgtgcttcacggattattgttaactcaccatctggtattggt
ggtatcggtaacatctacaataacatgacaccatcacttactttaggtacaggttcatac
ggtggtaactcaatttctcacaacgttactgattgggacctcttaaacatcaaaacaatt
gcaaagcggcgtgaaaatcgtcaatgggttaagattcccccaaaagtatactttcaacgc
aactcactaaaagaattgcaagatattccaaacattaaccgagcattcatcgttactggt
cctggaatgagcaagcgtggttacgttcaacgtgttatcgatcaattgcgtcaacgtcaa
aacaacactgccttcttagtatttgatgacgttgaagaagatccatcaacaaacactgtt
gaaaaaggtgttgccatgatgaatgacttcaagccggatacaattattgcccttggtggt
ggttcaccaatggatgctgctaaggcaatgtggatgttctatgagcacccagaaacttca
tggtatggagttatgcaaaagtaccttgatattcggaagcgtgcttaccaaatcaagaag
cctactaagtctcaacttattggtatccctactacatcaggtactggttcagaagttact
ccatttgcggttattaccgattcagaaactcatgttaagtacccacttgctgactacgcc
ttaactccaaacattgcgattgttgactcacaattcgttgaaactgtcccagcaaaaact
actgcatggactggactagatgttttatgtcacgctactgaatcatatgtttctgttatg
gcaaccgactacactcgtggttggtcacttcaaaccatcaagggtgttatggaaaacctt
cctaagtcagttcaaggtgataagctagctcgtcgtaagatgcacgacttctcaacaatg
gccggtatggcatttggtcaagccttcttaggaattaaccactcccttgctcacaagatg
ggtggagcattcggtcttcctcacggtttacttatcgctattgcaatgccacaagtaatt
cgctttaacgcaaaacgtccacaaaagcttgctctctggcctcactatgagacttaccat
gcaactaaggactatgctgacattgcacggttcattggtttgaaaggcaacactgatgaa
gaattagctgaagcatatgctaagaaagttatcgaacttgctcacgaatgtggtgttaag
cttagtcttaaggacaatggtgttacacgtgaagaatttgataaggctgttgacgatctt
gctcgcttagcttacgaagatcaatgtactactactaacccagttgaaccacttgttagc
caactcaaggaattacttgaacgttgctacgatggtactggcgttgaagaaaaataa

DBGET integrated database retrieval system