KEGG   Lactobacillus reuteri I5007: LRI_1709Help
Entry
LRI_1709          CDS       T02701                                 

Definition
(RefSeq) glutaminase
  KO
K01425  
glutaminase [EC:3.5.1.2]
Organism
lrt  Lactobacillus reuteri I5007
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lrt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LRI_1709
   00220 Arginine biosynthesis
    LRI_1709
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LRI_1709
Enzymes [BR:lrt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     LRI_1709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1756105..1757019)
Genome map
AA seq 304 aa AA seqDB search
MQKLEQLIDKNFAETAHGKVANYIPILGIVDPQQLGIAIYDVDEDEIGIAGMAGTRFAIE
SIAKVITLILAIKRLGHKRVLAELENGSADYSLSSVLLDDELTEQVHRVNYLNNSSALLT
TALIDQLMGQNSFNALLGFCREICNDPCISLNERLFRSAIMNDKDIHALAYYMKDKDILE
TVDQTLITYFMQSSMMVTSQSLANLGAVLANDGIKPWDNERLISHEDNELVKKLLTTVGS
FEESKEYTIKIELPIKSGTGGGLLACAPQKCGIGIFSPALDQHGNSLAGMSLLQDVVDQL
ELVV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaattagagcaattgattgataaaaactttgctgaaacagctcatggtaaggtt
gcaaactatattccgatattaggaattgttgatccgcagcaattgggcattgccatttat
gacgttgacgaggacgaaattgggatcgctggaatggcaggaacgagatttgcaatcgag
agtattgcgaaggtcataactttaatattagcgatcaagagattaggacataagcgcgtc
ttagcagaactagaaaatggttcggcagattatagcctaagttcggtactattggatgat
gagttaaccgagcaggtccaccgggtaaattatcttaataattcctccgccttgttaacg
acagccttaattgaccagttgatggggcagaatagttttaatgcccttctcggtttctgc
cgtgagatctgtaatgacccatgcattagcttgaatgaacgtttatttcggtcagcaatt
atgaatgataaagatattcatgcactggcttactatatgaaagataaggatattttagag
actgttgatcaaacattgataacttactttatgcaaagttcaatgatggtgacatcacag
agtcttgctaacttaggagcagtcttggcaaatgatggaattaaaccttgggataatgag
cgtcttattagccatgaagataacgagttggtaaagaaattgctaacaacagttggttcg
tttgaagaatcaaaagaatacacaattaaaattgaactccctattaaaagtggtactggc
ggtggcttattggcttgtgccccgcaaaaatgtggtattggtatttttagtccagctctt
gatcaacatggcaatagtttggcaggaatgagtttattacaagatgttgttgatcaatta
gaattagtagtttaa

DBGET integrated database retrieval system