KEGG   Lactobacillus reuteri SD2112: HMPREF0538_20141Help
Entry
HMPREF0538_20141  CDS       T01551                                 

Gene name
lacZ
Definition
beta-galactosidase 1 (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF0538_20141 (lacZ)
Enzymes [BR:lru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     HMPREF0538_20141 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(138194..140212)
Genome map
AA seq 672 aa AA seqDB search
MMKKELPRFLYGGDYNPEQWPEETWAEDIKVFKRADINTATINVFSWALLEPQEGKYDFT
KLDKIIKELTAADFDIVLATSTAAMPAWMFKKYPDVARVDYQGRRHVFGARHNFCPSSKN
YRRLAKNLVEQLAKRYGDNPHIVAWHVNNEYGGNCYCEECQTEFQQWLKARYQTLNNLNH
AWNMNVWSHTIYDWNEIVVPNELGDAWGSEGSETIVAGLSIDYLRFQSTQMLDLFKMEKQ
IIEKYDPTTLVTTNFHSLPNKMIDYQQWASAQDIISYDSYPAYDAPVYQPAFLYDLMRSL
KHQPFMLMESTPSQVNWQPYSPLKRPGQMAATELQAVAHGADTVQFFQLKQALGGSEKFH
GAVISHANRTDTRAFKEVAKLGHDLRKVGPVIKDSQTKARVALIFDWSNFWSFEYVDGIT
QALKYVPIILDYYRQFYELNIPIDVISVDDDFSQYDLVVAPVLYMVKDGLGKKITDYVAN
GGNFITSFMSGMVNESDNIYPGGYPGPLKDVMGLWVEESDAILPDKDVKLAMTTGNELTG
HLIADLICLNGAHVLAKYASEFYAGTPAVTENTYSKGKAWYVGSRLDHASLRKIIMHIVD
DVHLSALVKEQTELEITKRQNSAGQDIYFVLNMGKGKQPLPVEFQKGYRDLLTGDFPETM
LDSWDVEILVQE
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaaagaattgcctcgtttcttatatggtggcgactataatcccgaacagtgg
ccagaagaaacgtgggctgaagatattaaagtatttaagcgggcagatataaataccgcc
acgatcaatgttttttcatgggccttgcttgaaccgcaggaaggaaaatacgattttacc
aagcttgataaaattatcaaagaattaacggctgctgattttgatatcgttcttgccact
tcaaccgccgcgatgcccgcttggatgttcaagaaatacccagatgttgcgcgggtcgac
taccaaggacgccgccatgtatttggtgcccggcataacttttgcccaagcagtaaaaat
tatcggcgtttagcgaaaaatcttgttgaacagctcgctaaaagatatggcgataatccg
catattgttgcttggcatgttaataatgaatatggtggcaattgttattgtgaagaatgc
caaacagaatttcagcaatggttgaaggcgcgctatcaaaccttaaataatcttaatcat
gcatggaatatgaatgtgtggagtcatacaatttatgactggaatgagattgttgtgcct
aatgaacttggtgatgcatggggctcagaaggatcggaaacaattgtcgccggactttca
attgattatttacgttttcaatcgacccaaatgcttgatttatttaagatggaaaagcaa
atcattgaaaagtatgatccaacgaccttagtcactactaactttcatagtctgcccaat
aaaatgattgattatcagcagtgggctagtgcgcaagacattatatcatatgatagttat
ccggcttatgatgcaccggtttatcagccagcattcttatatgatttgatgcgttcttta
aagcaccagccgtttatgctgatggaatccacgccatcacaagttaactggcaaccatat
agcccattaaaacgtccgggacagatggcggccactgaattacaggcagttgcgcatggt
gcggatactgttcaatttttccagttgaagcaggcactgggcggatcagaaaagtttcat
ggtgctgtgattagtcacgccaaccggactgatacccgggcatttaaagaagtggcgaaa
ttaggtcatgatttaagaaaagtgggcccggttattaaagattctcagactaaagcgcgg
gtggcccttatctttgactggagtaatttctggtcttttgagtatgtcgatggtattacc
caggccctaaaatatgtaccaattattcttgattattaccggcaattttatgagctgaat
attccgattgatgtaatttccgttgatgatgattttagccaatatgacctcgtagttgct
ccggtcctttacatggttaaggatggcttaggcaagaagattacagattatgttgcaaac
ggtggtaattttattactagttttatgtccggaatggtaaatgaatccgataatatctat
ccgggcggttatcctggaccattaaaagatgtaatggggctgtgggttgaagaaagcgat
gcaatccttcctgataaagatgttaaattagcaatgacgaccgggaatgaactaactgga
catttaatagcagatttaatttgccttaatggagcccatgtcctggctaaatacgctagt
gaattttatgcagggactcccgcggtaaccgagaatacctattcaaaagggaaagcatgg
tatgttggtagtcgccttgaccatgctagtctccgtaagatcattatgcatattgttgat
gatgtgcacctttccgcgttagtcaaagagcaaacagaattggagataacaaaacgccaa
aattcagcaggtcaggatatttactttgtccttaatatgggaaagggtaaacaaccatta
ccagtagaatttcaaaagggatatcgagaccttttgactggcgattttcctgaaacgatg
cttgattcgtgggatgttgagatcttggttcaagaataa

DBGET integrated database retrieval system