KEGG   Lactobacillus reuteri SD2112: HMPREF0538_20211Help
Entry
HMPREF0538_20211  CDS       T01551                                 

Gene name
gltX
Definition
glutamate--tRNA ligase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lru00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(202539..204044)
Genome map
AA seq 501 aa AA seqDB search
MDQKVRVRYAPSPTGFLHIGNAQSALFNYLFARHFDGTMVLRIEDTDTKRNVEDGEASQR
ENLHWLGIDWDEGPNKPNPKYAPYRQSERNKEGIYHKYIQELLDKGIAYKDYSTEEELAE
MRERQKANNEPPHYDGRWYGKSEEEQKAAEAKGLKPTIRFHFPKDHDYEWDDIARGHVSF
NSDNLGGDFIIEKSDGMPTYNFAVVVDDHTMDITHVLRGADHISNTPKQIAIYEALGWDH
PTFCHIPLIFNPKTRKKLSKRDKDTLQFISEYKKHGYLHEAIFNFIAFLGWSPVGEREIY
SKEELIKVYDPKRMSKAPAYFDQKKLDWMNAQYIKSMSIDKLTDRTMELIKEGETEEAKR
LQSIPEDQLTELLKKTIKVHQRDINKLLEVIQYAWSYYTVLDQSFNYDLLKDNEDFANED
VLAVLKGLKAKLENGGDDLDYSQAIKEVGKDTGIKGRGLYFPLNLAFTGSTSAPQIYEIM
DIYSRDTDIELLDRMIKAFEN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaaggtcagagttcgatatgcacctagcccaacaggtttcttacatatcgga
aatgctcaatcagcattatttaattatttatttgcacgtcacttcgatggaacgatggta
ttacggattgaagataccgataccaagcggaacgttgaagatggtgaagctagccaacgt
gaaaatcttcactggttaggaattgactgggatgaaggtccaaataagccaaatccaaag
tatgccccttaccgtcaaagtgaacggaataaagaaggtatttaccacaaatacattcaa
gaattattagacaagggcattgcatacaaggattactcaacagaggaagaattagctgaa
atgcgtgaacggcaaaaggctaacaatgaacctcctcattatgatggtcgttggtatggc
aagagtgaagaagaacaaaaggctgctgaagcaaagggattgaagccaactattcgtttc
cacttccctaaagaccatgattacgaatgggacgatattgcacgtggtcatgtttcattt
aactctgacaaccttggtggtgatttcatcattgaaaagagtgatggaatgccaacatat
aactttgccgtagtagttgatgaccacaccatggacattacccatgttttgcgtggcgct
gatcacatttcaaatacgccaaagcaaattgctatttatgaagcattgggctgggatcac
ccaactttctgtcacattccattgatctttaatccaaagactcgcaagaagttaagtaag
cgtgataaagatacccttcaattcattagtgaatacaagaagcacggttaccttcacgaa
gcaatctttaactttattgcattcttaggttggtctccagttggcgaacgtgaaatctac
tctaaagaagagttgattaaggtgtacgatccaaaacggatgtcaaaggcaccagcatac
ttcgatcaaaagaaacttgattggatgaatgctcaatacattaagagtatgtcgatcgat
aaattaactgatcggacaatggaattaattaaggaaggcgaaactgaagaagctaagcgc
cttcaaagtattccagaagatcaattgactgaattgcttaagaagacaattaaagttcac
caacgggatattaataagcttcttgaagttattcaatatgcatggtcatactacacggtt
cttgaccaatcattcaactatgatttgcttaaggacaacgaagacttcgctaatgaagat
gttttagctgttcttaagggcttaaaggctaaacttgaaaacggtggcgatgaccttgat
tacagtcaagctattaaggaagtgggtaaggacactggtattaagggtcgtggtttatac
ttcccattaaaccttgcctttactggttcaacttctgcaccacaaatctatgaaattatg
gatatttattcacgtgatacagatattgaattgcttgaccggatgatcaaagcatttgaa
aactaa

DBGET integrated database retrieval system