KEGG   Lactobacillus reuteri SD2112: HMPREF0538_20260Help
Entry
HMPREF0538_20260  CDS       T01551                                 

Gene name
fpg
Definition
DNA-formamidopyrimidine glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:lru03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(246356..247186)
Genome map
AA seq 276 aa AA seqDB search
MPELPEVETVRRGLLKIAAKRKINAIDVYYGKTITNDVEDFRQALIGQTIENVDRRGKYL
LFRFTNDLTMISHLRMEGKYYNQPIGGPIDKHTHVVFEFTDGTELCYQDTRKFGRMTLVK
TGDEMNVGGLKTIGPEPTEDAFTLPYFTAELKKSRGKIKPFLLNQRHVAGLGNIYVDEVL
WMTGINPEQPANTLTASQITELRKNIIKELATAIKYKGTTVHSFTNAFGDAGAFQDRLKA
YGHAGDECPRCGTKMVKIKVAERGTTFCPHCQVLKE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaagttgaaactgttcgccgcggtttgctgaagattgccgctaag
cgtaaaattaacgcgatcgatgtttattatggtaaaacgattaccaatgacgttgaagat
tttcggcaggcgttgattggacagacgattgaaaatgttgatcggcgagggaaatatctt
ctttttcgttttactaatgatttgacgatgatttcacaccttcgcatggaaggaaaatat
tacaaccaaccgattggcggaccaattgataaacatacccatgttgtctttgaatttacg
gacggcacggaattatgttatcaagatacccgtaaatttggtcggatgacactggtaaaa
accggtgatgagatgaatgtcggcggattgaagacgattggccctgaaccgacggaagac
gcctttacgttgccatactttacagctgaattaaaaaagagtcggggaaagattaagcca
ttcttgcttaatcagcgtcatgtcgccggtctgggtaacatttacgttgatgaggtacta
tggatgacggggataaatccggagcaaccagccaatactttaacggctagccagattact
gaattacggaaaaatattatcaaagaattggcgacagcgattaagtacaagggaaccact
gtgcatagttttacgaatgcatttggtgatgccggcgctttccaagatcgcttaaaagct
tatggtcatgcgggggatgaatgtccgcgttgtggcacgaaaatggttaaaattaaggtt
gctgaacgtggaacgacattttgtccacactgtcaagtattgaaggaataa

DBGET integrated database retrieval system