KEGG   Lactobacillus reuteri SD2112: HMPREF0538_20288Help
Entry
HMPREF0538_20288  CDS       T01551                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lru00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(277203..278366)
Genome map
AA seq 387 aa AA seqDB search
MKVTENLVTKDYSKLVSAILADQVNRHQQLLLTWECPDVETAGMVERFIRHFDTPVACVE
KRVEFSFPLLSLKELIARVKERWENDQELIASLEQVYRRHQIIWRAGRFTFDLTEQPVIY
GILNVTPDSFYDGGKFQSHSAIASQIAKMVAAGANVIEVGGQTTKPGGFKEVDPEEEIAR
IMPAIQLLRENYPQLAIAVDTYKLPVMAAAIEAGVDIINDVQAFNSKQKLILMAKANVGM
VTMHSSRTHDYDNLTVAMQKFFEHNLGTIAAAGIDLERVILDQGIGYAKVADGYQDYAMM
RNIDQLNYLHRPIMVAISRKGFGQKLFNLAKEDRLGVTLIAETAMYLRGGRVLRVHDVEE
TSQLVKMIDTIENSYWFRSTNSQFPRQ
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttactgaaaatttagttactaaagactattcgaagttagtgtccgcgatctta
gccgaccaagttaatcgccatcagcagcttttattgacgtgggagtgtccagatgtggag
acggctggaatggtagagcgatttatccgtcattttgatacccctgtcgcttgtgttgaa
aagcgcgtagaattttctttcccgctcctttccctaaaagaactaatagcacgggtgaaa
gagcggtgggagaacgaccaagaattaattgcttctcttgaacaggtttaccgtcgtcac
cagattatttggcgtgcaggccggtttacttttgatctgacagagcaaccggtgatttat
ggaattttaaatgtaactcctgactcattttatgatgggggtaaatttcaatcccattcc
gctattgctagtcaaattgctaagatggtggcagctggggcaaacgtaattgaagtcggt
gggcaaactacgaaaccgggtggctttaaagaggttgatccggaagaagaaattgcgcga
attatgccggctattcagcttcttcgtgaaaactatccccagcttgcgatcgcagttgat
acgtataaactcccagtaatggcagcggcaattgaggccggggtagatattatcaatgat
gtgcaggcatttaattcaaaacaaaaactaattttgatggctaaggcaaatgttggaatg
gtaacgatgcatagcagccgaacccatgactatgataatctcaccgtagcgatgcagaaa
ttctttgaacacaatcttgggacaatagcggctgctggcattgatcttgaacgagtgatt
ttagaccaaggaattggctatgcaaaggttgctgacggttaccaagattatgcgatgatg
cgcaacattgaccagcttaattacctccatcgcccaattatggttgcgatctcccgaaaa
ggttttggtcaaaaattatttaatctagcaaaagaagaccgtctcggcgtaacattgatt
gctgagacagcaatgtatttgcgaggcggtcgtgttttacgagttcatgatgttgaggaa
actagtcagttagtgaaaatgatcgatactattgaaaatagttactggtttagatccacc
aacagccaattcccaaggcaataa

DBGET integrated database retrieval system