KEGG   Lactobacillus reuteri SD2112: HMPREF0538_20288Help
Entry
HMPREF0538_20288  CDS       T01551                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMPREF0538_20288 (folP)
Enzymes [BR:lru01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     HMPREF0538_20288 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(277203..278366)
Genome map
AA seq 387 aa AA seqDB search
MKVTENLVTKDYSKLVSAILADQVNRHQQLLLTWECPDVETAGMVERFIRHFDTPVACVE
KRVEFSFPLLSLKELIARVKERWENDQELIASLEQVYRRHQIIWRAGRFTFDLTEQPVIY
GILNVTPDSFYDGGKFQSHSAIASQIAKMVAAGANVIEVGGQTTKPGGFKEVDPEEEIAR
IMPAIQLLRENYPQLAIAVDTYKLPVMAAAIEAGVDIINDVQAFNSKQKLILMAKANVGM
VTMHSSRTHDYDNLTVAMQKFFEHNLGTIAAAGIDLERVILDQGIGYAKVADGYQDYAMM
RNIDQLNYLHRPIMVAISRKGFGQKLFNLAKEDRLGVTLIAETAMYLRGGRVLRVHDVEE
TSQLVKMIDTIENSYWFRSTNSQFPRQ
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttactgaaaatttagttactaaagactattcgaagttagtgtccgcgatctta
gccgaccaagttaatcgccatcagcagcttttattgacgtgggagtgtccagatgtggag
acggctggaatggtagagcgatttatccgtcattttgatacccctgtcgcttgtgttgaa
aagcgcgtagaattttctttcccgctcctttccctaaaagaactaatagcacgggtgaaa
gagcggtgggagaacgaccaagaattaattgcttctcttgaacaggtttaccgtcgtcac
cagattatttggcgtgcaggccggtttacttttgatctgacagagcaaccggtgatttat
ggaattttaaatgtaactcctgactcattttatgatgggggtaaatttcaatcccattcc
gctattgctagtcaaattgctaagatggtggcagctggggcaaacgtaattgaagtcggt
gggcaaactacgaaaccgggtggctttaaagaggttgatccggaagaagaaattgcgcga
attatgccggctattcagcttcttcgtgaaaactatccccagcttgcgatcgcagttgat
acgtataaactcccagtaatggcagcggcaattgaggccggggtagatattatcaatgat
gtgcaggcatttaattcaaaacaaaaactaattttgatggctaaggcaaatgttggaatg
gtaacgatgcatagcagccgaacccatgactatgataatctcaccgtagcgatgcagaaa
ttctttgaacacaatcttgggacaatagcggctgctggcattgatcttgaacgagtgatt
ttagaccaaggaattggctatgcaaaggttgctgacggttaccaagattatgcgatgatg
cgcaacattgaccagcttaattacctccatcgcccaattatggttgcgatctcccgaaaa
ggttttggtcaaaaattatttaatctagcaaaagaagaccgtctcggcgtaacattgatt
gctgagacagcaatgtatttgcgaggcggtcgtgttttacgagttcatgatgttgaggaa
actagtcagttagtgaaaatgatcgatactattgaaaatagttactggtttagatccacc
aacagccaattcccaaggcaataa

DBGET integrated database retrieval system