KEGG   Lactobacillus reuteri SD2112: HMPREF0538_20299Help
Entry
HMPREF0538_20299  CDS       T01551                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF0538_20299 (rbsK)
Enzymes [BR:lru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HMPREF0538_20299 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(285888..286811)
Genome map
AA seq 307 aa AA seqDB search
MTNHVTIVGSLNVDTTMKVKRMPLPGETIAALSKTNAAGGKGANQAVAAARSGAETAFVG
QVGDDAGGKMMINDLKNNNVDTTGIHVDDQAGTGSAAILLDESGQNSILVYGGANQQLSV
KGVEDARDQIAATDFVIAQFETPQEATLRAFQIAKENGVKTILNPAPAHEINPDLLKLTD
LIIPNETESAALTGIIVTDETSMLMSAAKFAQMGVRNLIITVGAKGAFYCTQDGYNFIPA
FKVNAVDTTAAGDTFIGALSSQLKPDMSNIEKAIVYAQRASSLAVQKLGALPSIPTYDEV
VAASKNN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatcatgtaacaattgtaggcagtttaaatgttgatacaacaatgaaagttaag
cggatgccattacctggggaaacaattgccgctttaagcaagactaatgctgctggggga
aagggagcaaaccaagccgttgctgctgctcgttcaggcgctgaaacagcttttgttggt
caagttggtgatgacgctggtggtaagatgatgatcaatgacctcaagaacaacaacgtc
gacacaacagggatccacgttgacgatcaagcaggtactggatctgcagccatcttgctt
gatgaaagtggtcaaaacagtatcttagtgtacggaggagctaaccaacaattaagcgtt
aagggagtagaagatgctcgtgatcaaattgccgctactgatttcgtgattgctcaattt
gaaactccacaagaagctactctacgggcattccaaattgcaaaggaaaatggtgtaaag
acaatcttaaatcctgctcctgctcatgaaattaaccctgatttattgaagttaacagac
ttaatcattccaaatgaaacagagagtgctgctttaacaggaattattgttacagacgaa
acttcaatgcttatgtcagctgcaaagtttgctcaaatgggtgtccgaaacttaattatt
actgttggtgcaaagggtgccttctactgtactcaagatggctacaactttattcctgct
tttaaggttaatgctgttgataccactgccgctggtgataccttcatcggtgcgctttca
tcccaattaaagcctgatatgagtaacattgaaaaggcaattgtctacgctcaacgtgca
agttcattagctgttcaaaagcttggtgcattaccatcaattcctacttatgacgaagta
gttgctgcatcaaagaataactag

DBGET integrated database retrieval system