KEGG   Lactobacillus reuteri SD2112: HMPREF0538_20674Help
Entry
HMPREF0538_20674  CDS       T01551                                 

Gene name
scrP
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0538_20674 (scrP)
Enzymes [BR:lru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     HMPREF0538_20674 (scrP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(663283..664740)
Genome map
AA seq 485 aa AA seqDB search
MPIKNEAMLITYSDSMGKNIKETHEVLKNYIGDAIGGVHLLPFFPSTGDRGFAPYRYDVV
DSAFGNWDDVEALGEDYYLMFDFMINHISKKSEMYQDFKKKHDDSKYNDFFIRWEKFWEK
AGKNRPTQEDVDLIYKRKDKAPKQEITFDDGTTENLWNTFGEEQIDINVKSKVANEFFKE
TLIDMVKHGADMIRLDAFAYAIKKVGTNDFFVEPEIWDLLNEVQDILAPYKAIILPEIHE
HYTIPQKISQHDFFIYDFTLPMTTLYTLYSGKTNRLAKWLKMSPMKQFTTLDTHDGIGVV
DAKDILTDDEIEYASNELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDDDKAYLLS
RAFQVFAPGIPMVYYVGLLAGSNDLELLEKTKEGRNINRHYYTKEEVAQEVQRPVVKNLL
DLLAWRNKFAAFDLDGSIEVETPTETTIKVTRKDKDGKNVAVLDADAANKTFTITANGEK
VMEQK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgccaatcaaaaatgaagcaatgttaattacttactctgactcaatgggtaaaaatatt
aaagaaactcatgaagtattaaagaactatatcggtgatgcgatcggcggtgttcactta
cttccgttcttcccatcaactggtgaccgtggtttcgcaccataccgttacgatgttgtt
gattctgcttttggtaactgggatgatgttgaagcattaggtgaagactactacttaatg
tttgacttcatgattaaccatatttccaagaagtctgaaatgtaccaagacttcaagaag
aagcacgatgattctaagtacaacgacttctttattcgttgggaaaagttctgggaaaaa
gctggtaagaaccgtccaactcaagaagatgttgatttaatttacaagcgaaaggataag
gctcctaagcaagaaattacctttgatgatggtactactgaaaacttatggaacactttc
ggtgaagaacaaattgatattaatgttaagagtaaggtagctaacgaattcttcaaggaa
acattaattgacatggttaagcacggtgcagatatgattcgtcttgatgcctttgcttac
gctattaagaaggttggtactaatgatttcttcgttgaacctgaaatctgggatctctta
aatgaagttcaagatattttggctccttacaaggccatcatccttcctgaaattcacgaa
cactacaccattccacaaaagatttcacaacatgacttcttcatctatgactttacctta
ccaatgactactctttataccctttactctggtaagactaaccgccttgctaagtggtta
aagatgtcaccaatgaagcaatttactactcttgatactcatgatggtattggggttgtt
gatgctaaggatatcttaactgatgatgaaatcgaatatgcatccaatgaattatacaag
gttggtgctaacgttaagcggaaatactcaagtgctgaatacaacaacttggatatttac
caaattaactctacttactactctgcattaggtgacgatgacaaagcttacttgctttct
cgtgcattccaagtatttgcacctggtattccaatggtttactatgttggtttacttgct
ggttcaaatgaccttgaattacttgaaaagactaaggaaggtcggaacatcaaccgtcac
tactacactaaagaagaagttgcacaagaagttcaacgtccagtagttaagaatctctta
gacttacttgcatggcggaataaatttgcagcctttgatcttgatggttcaattgaagtg
gaaacaccaactgaaacaactatcaaggttacgcggaaagataaggatggcaagaatgtg
gctgttcttgatgctgatgctgctaacaagactttcactattacagctaatggtgaaaaa
gtgatggaacaaaaatag

DBGET integrated database retrieval system