KEGG   Lactobacillus reuteri SD2112: HMPREF0538_20888Help
Entry
HMPREF0538_20888  CDS       T01551                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF0538_20888 (hemB)
Enzymes [BR:lru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     HMPREF0538_20888 (hemB)
Exosome [BR:lru04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0538_20888 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(878267..879238)
Genome map
AA seq 323 aa AA seqDB search
MLQFDRHRRLRTSAAMRDLVRETHLNKDDLIMPVFVDATINGKEEIPSMPGIYRYSLDTI
LDEIKEIVDLGIKSIIIFGVPEKKDEVGTGAWEENGIVQQAIRLIKKNYPELIVIADTCL
CEYTSTGHCGILKDGIVLNDESLEYLTKTAVSQVAAGADIIAPSNAMDGYVAAIRQGLDE
AGFKNTPIMSYAVKFASSFYGPFRDAADGSPKEGPKDRKTYQMDPANRLEALREVASDEK
EGADFVMVKPAMAFLDIMREVRNHTLLPLVAYNVSGEYAMVKAATANGWINEDQIVYESL
VGMKRAGADLIITYFAKDVAKKL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaatttgatcgtcatcgtcgtttacgtactagcgctgcaatgcgagatttggta
agagaaactcatttaaataaagatgatttaattatgccggttttcgtggacgcaacaatc
aacggcaaagaagaaattccgtcaatgccgggaatttaccggtatagtcttgataccatt
ttggatgaaatcaaggaaatcgtggaccttggtattaaatcaattattatttttggtgtt
ccagagaaaaaagacgaggttggaaccggcgcttgggaagagaatggtattgtccaacaa
gcgattcggttaatcaagaaaaactatcctgaattaatcgtaattgcagatacctgctta
tgtgaatacaccagtaccggtcactgcggaattcttaaagacggaatagtcttaaacgat
gaatccttagaatatcttactaaaacagcagttagccaagtggcagccggtgcggatatt
attgcgccatcaaatgcaatggacggttatgtcgctgctattcgtcaaggattagatgaa
gcaggattcaagaacacaccaattatgtcctatgcggttaagtttgcttcttcattctac
ggtccattccgtgacgcagcagatggttcacctaaagaaggacctaaagatcgaaaaaca
taccaaatggatccagctaatcgcctagaagcattgcgtgaagtagctagtgatgaaaag
gaaggtgctgattttgtgatggttaaaccagcaatggccttcttagatattatgcgtgaa
gttcgtaaccatactttattaccactagttgcatataatgtttctggtgaatatgcaatg
gttaaggcagctacagctaatggctggattaatgaggaccaaatagtttatgaaagtttg
gttggaatgaaacgagctggggcagacttaattattacttactttgccaaggacgttgct
aaaaaactttaa

DBGET integrated database retrieval system