KEGG   Lactobacillus reuteri SD2112: HMPREF0538_20899Help
Entry
HMPREF0538_20899  CDS       T01551                                 

Gene name
cobA
Definition
uroporphyrinogen-III C-methyltransferase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:lru00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(887554..888948)
Genome map
AA seq 464 aa AA seqDB search
MSGRVTLLGAGPGNPELLTLIGKRRLGEADVVLYDRLIDPSLLSFTNDDATLVDVGKMPL
HHKVKQSQINEMLVDYANLGKKVVRLKAGDPYVFGRGGEEAQILQQQGINFEIIPGITSA
IAGLAAAGIPITHRDFASSFHVITGHHKKDGQQLDWENIANQEGTLVFLMGMAQLPNICH
QLIAHGKAVETPVAIIQWATQWRQKMVSGDLSNIVELVNKNGLSSPALIVVGNVVKLSKQ
LNVAKPLAGVHVLVPYSKRQRLFNCLEDLGATADFYQRSIVESAPAKLPVLDSYSSILFD
DYLAYKEFIKLLTASKKDIRALVGKKILAGNQSVANHLAKQGLLVDEVVATNKLSDDVLE
VGGQNSSYSHKEFLSLYQRKEQTHELPFDLAEFNAVIFPSTASLRDFKSTLNEEQFKQLK
DLTAFVMGQSIYDLATQNGFKKVINCQPNIKATIEQVKEELASE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtagagtaacgctcctcggtgcaggtcctgggaatcctgaactattaacatta
atcggtaaacggcggctgggagaggctgacgtagtattatatgatcggttaattgatcca
tcattattatcatttacaaatgatgatgcgaccctagttgatgttggaaaaatgcctctg
caccataaagtgaagcagtcccaaatcaatgagatgttagttgattatgcaaacttaggg
aaaaaagtggttcggttaaaagctggcgacccatatgtctttggccgtggtggcgaagag
gctcagatactacaacagcagggaattaactttgaaattattcctggaattactagtgcc
attgctgggttagcggctgcgggaattccgattacccatcgtgattttgcgtcgagcttc
cacgtgattacgggacatcataaaaaggatgggcagcaactcgattgggaaaacatcgct
aaccaagaaggaacgcttgttttcttgatggggatggcgcaacttcctaatatatgtcat
caattgatagctcatggaaaagcggtggaaacccccgttgcaattattcaatgggcaact
caatggcgacaaaagatggtcagtggtgatctttcaaatattgtggaattggtaaataaa
aacgggttatcatcaccagcattaatagtggtagggaatgttgttaagcttagtaagcag
ttgaatgttgctaagccgcttgcaggagtccatgtattagtaccatatagtaagaggcag
cgattatttaactgcttggaagatttaggcgcaactgcggacttttatcagcgatcaata
gtagaatccgccccagctaagttacccgttcttgattcatattcgtcaatcctatttgat
gattatcttgcttataaagaatttattaaattgcttacagcaagcaaaaaagatattcgc
gcattggtaggtaaaaagattcttgcaggtaatcaaagtgttgccaaccatcttgcaaaa
caggggttgttggtagatgaagttgttgcaacgaacaaactttctgatgatgtacttgaa
gttggtggccaaaattcgtcttattcacataaagaatttcttagtctctaccaacgaaaa
gaacaaacacatgagttaccgtttgaccttgcagaatttaatgcagtgattttccctagc
actgctagtctacgggattttaagagtacgttaaatgaagagcagtttaagcaattaaag
gacctaacagcctttgtgatgggacaatccatttatgatcttgcaacgcagaatggtttt
aaaaaagtaatcaattgtcagccaaatattaaagcaacaattgagcaggtaaaggaggag
ttagcgagtgaataa

DBGET integrated database retrieval system