KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21283Help
Entry
HMPREF0538_21283  CDS       T01551                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
lru00260  Glycine, serine and threonine metabolism
lru01100  Metabolic pathways
lru01110  Biosynthesis of secondary metabolites
lru01120  Microbial metabolism in diverse environments
lru01230  Biosynthesis of amino acids
Module
lru_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0538_21283 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF0538_21283 (thrC)
Enzymes [BR:lru01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF0538_21283 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEI57493
UniProt: F8DRL5
Position
complement(1281380..1282873)
Genome map
AA seq 497 aa AA seqDB search
MDYRSTQGDLSTILKSPTAILQGLSPDGGLYVPLHFPQPTYNLATLISLPYQQLAATILN
WFFDEFTSDQLLKNANTAYGSQWDNRLIAPLTPKHASNYYLELFHGPTLAFKDIALQMLP
QLVSRAAQNTQLEKQIVILTATSGDTGTASMRGFSNQKDTQVIVFYPAGGVSPVQLRQML
GQPGSNLHAIAIKGNFDDAQTSVKHIFNDQAFNDRLAQNNNCFSSANSMNIGRLIPQIVY
YFAAYGQLVHTGGIQLGEKVNFTVPTGNFGDILAGYYAKKLGLPINKLLCASNENNVLTD
FFKSGKYERRRNFYLTNSPAMDILVSSNLERLLFDLYDESCVTVAKLMKQLATNGHYQVD
STVLNKLQEQFVAGFATPDEVEAEIKRVYLNDGYVIDPHTAVASHVTHQYQQQSHDTTPT
VIVSTASPYKFPETVYHALTNQKVSQSGLPALQQLHDLLGDQLSAGVQALVDQTPRQEKV
INPADMETLISKILNLK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggactaccgtagcactcagggagacttatcaacgattttaaaatcaccaactgctatc
ttacaaggactttctccagacggcggtctttatgtaccgcttcattttcctcaaccaact
tataaccttgcaaccttaatttcgttaccgtaccaacaacttgctgcaactattcttaac
tggttttttgatgaatttacgagcgaccaactactgaaaaatgcaaataccgcttatggt
agtcagtgggataaccgtttaattgccccattaacgcccaaacacgccagcaattattat
cttgagctttttcacgggccgacactggcatttaaggatatcgccttacaaatgttaccc
caattagtgtcacgtgctgcacaaaacacccaactagaaaaacaaatcgttatccttacc
gcaacttctggtgatactggaacagcctcaatgcgagggtttagcaatcaaaaagacaca
caggtaatcgtcttctaccctgctggcggggttagtccggttcaattacgccaaatgctg
gggcagcctggatcaaacctccacgcaatcgcaattaagggtaattttgatgatgcccaa
acaagcgttaaacatattttcaacgatcaagcatttaatgaccgccttgcgcaaaataat
aactgcttttcctcagctaattcaatgaatatcgggcggcttatcccccaaattgtgtac
tattttgctgcatacggacagcttgttcatacaggcgggatccaactaggggagaaagtt
aatttcaccgtgccgactggtaattttggcgatatcctcgctggttactacgctaaaaaa
ttaggcttaccaattaataagctcctgtgtgcttctaatgaaaacaatgtattgaccgac
tttttcaagagcggaaaatatgagcggcgacgcaacttttacctaactaactcaccagca
atggatattttagtatcaagtaatcttgagcggctcctctttgatctttatgatgaaagc
tgcgtaacagttgctaaattaatgaagcaattagctactaacggtcactaccaggtagat
tccaccgtattaaataagcttcaggagcaatttgtggctggttttgcgaccccagatgaa
gttgaagccgaaattaaacgagtatatttaaatgatggatatgttattgacccgcatact
gcagtggcatcacatgtaacacatcaatatcagcaacaaagccatgacacaactcccaca
gttatcgtgtcaactgccagtccatataaattccctgaaaccgtctaccacgcactaacc
aaccaaaaagttagtcaaagcgggcttcctgctcttcaacagttacatgatcttctggga
gatcagcttagcgctggtgtccaagcgttagtagaccaaacgccgcgccaagaaaaagtc
attaacccagcagacatggaaacattgataagtaaaattttaaacttaaagtaa

DBGET integrated database retrieval system