KEGG   Lactobacillus reuteri SD2112: HMPREF0538_21341Help
Entry
HMPREF0538_21341  CDS       T01551                                 

Gene name
tpiA
Definition
triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lru  Lactobacillus reuteri SD2112
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0538_21341 (tpiA)
   01230 Biosynthesis of amino acids
    HMPREF0538_21341 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0538_21341 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF0538_21341 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF0538_21341 (tpiA)
Enzymes [BR:lru01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF0538_21341 (tpiA)
Exosome [BR:lru04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF0538_21341 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF0538_21341 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF0538_21341 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1353616..1354410
Genome map
AA seq 264 aa AA seqDB search
MRKPFIAANWKMHKNVQESVEFVDAIKGKLPDPQEVEVGIAAQAFALPSMVHAADDSGLK
IIAQNAAAEYSGAFTGEISLRGLADAGVSYVMLGHIERRHLFHEDNELVNRKVLAALQMG
VTPIICTDETMVQKEVNGEIHYVFQQLMSVLRGVSLDQIKNVVVSYEPSWAVGYGQHANP
VLAEEGCRQIRRTIADNYTYEIADKIRILYGGSVNPDNIGMIMNKPDVDGVLIGRASLDV
DNFLRMVNYLKNLNFKNKLATGLK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaccctttattgctgctaattggaagatgcataagaatgtccaggaatcggtt
gaatttgtggacgcaattaaaggaaaactgccagatccgcaagaagttgaagtcggaatt
gcggcccaagcttttgcattaccgagtatggttcatgctgctgatgattcaggattaaag
ataatcgcgcaaaacgcggcagctgaatattcgggagctttcactggtgagattagctta
cgaggtttagctgatgccggtgtttcatacgtaatgttagggcatattgaacggcgccat
ttattccatgaggataatgagttggttaatcgaaaagtgttggcggcccttcaaatgggt
gttaccccgataatctgtacggatgaaacgatggttcaaaaagaagtcaacggagagatt
cattacgttttccaacaattaatgagtgtattgaggggcgtttctcttgaccaaataaaa
aatgtagttgtttcctatgaaccaagttgggcagttggatatggtcagcatgctaatcca
gttcttgctgaagaaggatgccgtcaaattcggcgaacgattgctgataactatacttat
gagattgctgataagatcaggattctttatgggggcagtgtcaatccagataatatcgga
atgattatgaacaagccggatgtggatggagtattaatcggtcgggcaagtttagatgtt
gataatttcttgcgaatggtcaattatcttaaaaacctaaatttcaagaataagttagcc
actggacttaaataa

DBGET integrated database retrieval system